KEGG   Escherichia coli K-12 W3110: JW2803
Entry
JW2803            CDS       T00068                                 

Symbol
ygeD
Name
(GenBank) predicted inner membrane protein
  KO
K08227  MFS transporter, LPLT family, lysophospholipid transporter
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW2803 (ygeD)
Transporters [BR:ecj02000]
 Major facilitator superfamily (MFS)
  Lipid transporters
   Lysophospholipid transporter (LplT) family [TC:2.A.1.42]
    JW2803 (ygeD)
SSDB
Motif
Pfam: MFS_1 DUF1427
Other DBs
NCBI-ProteinID: BAE76904
UniProt: P39196
Position
complement(2971325..2972518)
AA seq 397 aa
MSESVHTNTSLWSKGMKAVIVAQFLSAFGDNALLFATLALLKAQFYPEWSQPILQMVFVG
AYILFAPFVGQVADSFAKGRVMMFANGLKLLGAASICFGINPFLGYTLVGVGAAAYSPAK
YGILGELTTGSKLVKANGLMEASTIAAILLGSVAGGVLADWHVLVALAACALAYGGAVVA
NIYIPKLAAARPGQSWNLINMTRSFLNACTSLWRNGETRFSLVGTSLFWGAGVTLRFLLV
LWVPVALGITDNATPTYLNAMVAIGIVVGAGAAAKLVTLETVSRCMPAGILIGVVVLIFS
LQHELLPAYALLMLIGVMGGFFVVPLNALLQERGKKSVGAGNAIAVQNLGENSAMLLMLG
IYSLAVMIGIPVVPIGIGFGALFALAITALWIWQRRH
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgagtgagtcagtgcacactaacacttcgttgtggtcgaaggggatgaaagcggttatc
gtggcgcagtttctctctgcgtttggcgataatgccctactgtttgccactctggcgtta
ctgaaagcgcagttctatccggagtggagccagcccatcctgcaaatggtgtttgtaggt
gcttacattctttttgcgccgtttgtcgggcaggtggcggatagcttcgccaaaggccgg
gtgatgatgtttgccaacggcctgaagctgctgggcgcagccagtatctgctttggtatc
aatccgtttctcggctatacgctggtgggtgttggtgctgcagcctattcaccggcgaaa
tacggtattctcggcgaattaaccacgggtagtaagttagtgaaagctaacggtttaatg
gaagcttctaccatagcggcgattttgctcggttccgtagccggtggtgtgctggctgac
tggcatgtcctcgtcgccctggccgcatgcgcactggcctacggtggtgcggtcgttgcc
aatatctacattcccaaactggcggcggcgcgtccggggcagtcctggaatctcatcaac
atgacccgcagtttcctgaatgcctgcacctcgctatggcgcaatggtgaaacgcgtttt
tcgctggtgggcaccagtttattctggggagcgggtgtcacgctgcgtttcctgttggtg
ctgtgggtaccggtggcgctgggcattaccgataacgctacgcccacctatctcaacgcg
atggtagcgattggtatcgtggttggcgcaggtgcggcagcgaagttagttacgctggaa
accgtgtcacgctgtatgccagccgggattttgattggcgtggtggtactgattttttcc
ctgcaacacgagctgctgccagcctatgccttgttgatgctgattggcgtgatggggggc
ttttttgtcgttccgctcaatgcgttgctacaggagcggggtaaaaaaagcgtcggggcg
gggaatgcgattgcagtacaaaaccttggcgaaaacagcgccatgttgttgatgctgggc
atttactcgctggcggtaatgataggcatcccggtcgtgcccattggcattggcttcggt
gcgctgtttgcgctggcaataacggcgctgtggatctggcagcgccgtcattaa

DBGET integrated database retrieval system