KEGG   Escherichia coli K-12 W3110: JW2808Help
Entry
JW2808            CDS       T00068                                 

Gene name
ygeA
Definition
(GenBank) predicted racemase
Organism
ecj  Escherichia coli K-12 W3110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race Pantoate_transf
Motif
Other DBs
NCBI-ProteinID: BAE76909
UniProt: P03813
Structure
PDB: 

Position
complement(2978599..2979291)
Genome map
AA seq 230 aa AA seqDB search
MKTIGLLGGMSWESTIPYYRLINEGIKQRLGGLHSAQVLLHSVDFHEIEECQRRGEWDKT
GDILAEAALGLQRAGAEGIVLCTNTMHKVADAIESRCTLPFLHIADATGRAITGAGMTRV
ALLGTRYTMEQDFYRGRLTEQFSINCLIPEADERAKINQIIFEELCLGQFTEASRAYCAQ
VIARLAEQGAQGVIFGCTEIGLLVPEERSVLPVFDTAAIHAEDAVAFMLS
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaattggtttgctgggaggaatgagctgggaatccaccattccttactatcgt
ttgataaatgaaggcattaaacagcggcttggtgggcttcactctgcgcaagtgctgcta
catagcgtcgattttcatgaaatagaagagtgccagcgtcgcggggaatgggataaaacc
ggggacattctggctgaggcggcgcttggcttacagcgggcgggcgcagaaggtattgtg
ctatgtaccaatacgatgcataaagtggcggatgccattgagtcacgttgcactctgcct
ttcttacacattgcggatgccaccggacgtgcaattaccggggccggaatgactcgtgtg
gcgctgctgggtacgcgttacaccatggaacaggatttttatcgcgggcggctgacggaa
caattttccatcaattgtcttattcctgaagcggatgaacgggcgaaaattaatcagatt
atttttgaagaactgtgtctggggcaatttaccgaagcgtcacgcgcttattgtgcgcaa
gtgattgctcgccttgcagaacagggcgcacagggcgtcatttttggctgcacagaaatt
ggtttactggtgccagaagagcgcagtgttttgcctgtgtttgataccgcggcgatccat
gccgaggatgctgtcgcttttatgctgtcgtag

DBGET integrated database retrieval system