ecj:JW2861; : No such data.

KEGG   Escherichia coli K-12 MG1655: b2893
Entry
b2893             CDS       T00007                                 

Gene name
dsbC
Definition
(RefSeq) protein disulfide isomerase DsbC
  KO
K03981  thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:eco03110]
    b2893 (dsbC)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eco02044]
    b2893 (dsbC)
Enzymes [BR:eco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     b2893 (dsbC)
Chaperones and folding catalysts [BR:eco03110]
 Protein folding catalysts
  Protein disulfide isomerase
   b2893 (dsbC)
Secretion system [BR:eco02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   b2893 (dsbC)
SSDB
Motif
Pfam: Thioredoxin_2 DsbC_N DSBA Thioredoxin_4 TraF HxlR
Other DBs
NCBI-GeneID: 947363
NCBI-ProteinID: NP_417369
Pasteur: dsbC
RegulonDB: ECK120001059
ECOCYC: EG11070
ASAP: ABE-0009494
UniProt: P0AEG6
Structure
PDB: 

Position
complement(3038112..3038822)
AA seq 236 aa
MKKGFMLFTLLAAFSGFAQADDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYIT
DDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGY
CHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAP
ASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK
NT seq 711 nt   +upstreamnt  +downstreamnt
atgaagaaaggttttatgttgtttactttgttagcggcgttttcaggctttgctcaggct
gatgacgcggcaattcaacaaacgttagccaaaatgggcatcaaaagcagcgatattcag
cccgcgcctgtagctggcatgaagacagttctgactaacagcggcgtgttgtacatcacc
gatgatggtaaacatatcattcaggggccaatgtatgacgttagtggcacggctccggtc
aatgtcaccaataagatgctgttaaagcagttgaatgcgcttgaaaaagagatgatcgtt
tataaagcgccgcaggaaaaacacgtcatcaccgtgtttactgatattacctgtggttac
tgccacaaactgcatgagcaaatggcagactacaacgcgctggggatcaccgtgcgttat
cttgctttcccgcgccaggggctggacagcgatgcagagaaagaaatgaaagctatctgg
tgtgcgaaagataaaaacaaagcgtttgatgatgtgatggcaggtaaaagcgtcgcacca
gccagttgcgacgtggatattgccgaccattacgcacttggcgtccagcttggcgttagc
ggtactccggcagttgtgctgagcaatggcacacttgttccgggttaccagccgccgaaa
gagatgaaagaattcctcgacgaacaccaaaaaatgaccagcggtaaataa

DBGET integrated database retrieval system