KEGG   Escherichia coli K-12 W3110: JW2885Help
Entry
JW2885            CDS       T00068                                 

Gene name
argK
Definition
(GenBank) membrane ATPase/protein kinase
  KO
K07588  LAO/AO transport system kinase [EC:2.7.-.-]
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    JW2885 (argK)
Enzymes [BR:ecj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.-  Transferring phosphorus-containing groups
    2.7.-.-  
     JW2885 (argK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MeaB cobW CbiA IstB_IS21 ATP_bind_1 AAA_29 AAA_30 AAA_22 AAA_24 NTPase_1 ATPase AAA_18 PRK MobB DNA_photolyase ArsA_ATPase ABC_tran
Motif
Other DBs
NCBI-ProteinID: BAE76982
UniProt: P27254
Structure
PDB: 

Position
3061643..3062638
Genome map
AA seq 331 aa AA seqDB search
MINEATLAESIRRLRQGERATLAQAMTLVESRHPRHQALSTQLLDAIMPYCGNTLRLGVT
GTPGAGKSTFLEAFGMLLIREGLKVAVIAVDPSSPVTGGSILGDKTRMNDLARAEAAFIR
PVPSSGHLGGASQRARELMLLCEAAGYDVVIVETVGVGQSETEVARMVDCFISLQIAGGG
DDLQGIKKGLMEVADLIVINKDDGDNHTNVAIARHMYESALHILRRKYDEWQPRVLTCSA
LEKRGIDEIWHAIIDFKTALTASGRLQQVRQQQSVEWLRKQTEEEVLNHLFANEDFDRYY
RQTLLAVKNNTLSPRTGLRQLSEFIQTQYFD
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgattaatgaagccacgctggcagaaagtattcgccgcttacgtcagggtgagcgtgcc
acactcgcccaggccatgacgctggtggaaagccgtcacccgcgtcatcaggcactaagt
acgcagctgcttgatgccattatgccgtactgcggtaacaccctgcgactgggcgttacc
ggcacccccggcgcggggaaaagtacctttcttgaggcctttggcatgttgttgattcga
gagggattaaaggtcgcggttattgcggtcgatcccagcagcccggtcactggcggtagc
attctcggggataaaacccgcatgaatgacctggcgcgtgccgaagcggcgtttattcgc
ccggtaccatcctccggtcatctgggcggtgccagtcagcgagcgcgggaattaatgctg
ttatgcgaagcagcgggttatgacgtagtgattgtcgaaacggttggcgtcgggcagtcg
gaaacagaagtcgcccgcatggtggactgttttatctcgttgcaaattgccggtggcggc
gatgatctgcagggcattaaaaaagggctgatggaagtggctgatctgatcgttatcaac
aaagacgatggcgataaccataccaatgtcgccattgcccggcatatgtacgagagtgcc
ctgcatattctgcgacgtaaatacgacgaatggcagccacgggttctgacttgtagcgca
ctggaaaaacgtggaatcgatgagatctggcacgccatcatcgacttcaaaaccgcgcta
actgccagtggtcgtttacaacaagtgcggcaacaacaatcggtggaatggctgcgtaag
cagaccgaagaagaagtactgaatcacctgttcgcgaatgaagatttcgatcgctattac
cgccagacgcttttagcggtcaaaaacaatacgctctcaccgcgcaccggcctgcggcag
ctcagtgaatttatccagacgcaatattttgattaa

DBGET integrated database retrieval system