KEGG   Escherichia coli K-12 W3110: JW2982Help
Entry
JW2982            CDS       T00068                                 

Gene name
yqhH
Definition
(GenBank) predicted outer membrane lipoprotein
Organism
ecj  Escherichia coli K-12 W3110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LPP Cluap1 CLZ ZapB DUF16 DUF1993 DUF4201 DivIC Alanine_zipper Tropomyosin_1 DUF5082 Lebercilin PI3K_P85_iSH2 Glutaredoxin2_C Lzipper-MIP1 TMF_DNA_bd IncA Mnd1 DUF3138 SlyX ABC_tran_CTD Vac_Fusion DUF4988
Motif
Other DBs
NCBI-ProteinID: BAE77071
UniProt: P65298
Position
3157283..3157540
Genome map
AA seq 85 aa AA seqDB search
MKTIFTVGAVVLATCLLSGCVNEQKVNQLASNVQTLNAKIARLEQDMKALRPQIYAAKSE
ANRANTRLDAQDYFDCLRCLRMYAE
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgattttcaccgtgggagctgttgttctggcaacctgcttgctcagtggctgc
gtcaatgagcaaaaggtcaatcagctggcgagcaatgtgcaaacattaaatgccaaaatc
gcccggcttgagcaggatatgaaagcactacgcccacaaatctatgctgccaaatccgaa
gctaacagagccaatacgcgtcttgatgctcaggactattttgattgcctgcgctgcttg
cgtatgtacgcagaatga

DBGET integrated database retrieval system