KEGG   Escherichia coli K-12 W3110: JW2989Help
Entry
JW2989            CDS       T00068                                 

Gene name
ygiT
Definition
(GenBank) predicted DNA-binding transcriptional regulator
  KO
K13655  HTH-type transcriptional regulator / antitoxin MqsA
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecj03000]
    JW2989 (ygiT)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:ecj02048]
    JW2989 (ygiT)
Transcription factors [BR:ecj03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    JW2989 (ygiT)
Prokaryotic defense system [BR:ecj02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   MqsR-MqsA
    JW2989 (ygiT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MqsA_antitoxin HTH_3 HTH_31 Tn916-Xis
Motif
Other DBs
NCBI-ProteinID: BAE77077
UniProt: Q46864
Structure
PDB: 

Position
complement(3166507..3166902)
Genome map
AA seq 131 aa AA seqDB search
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAF
RASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVL
DKHPELLNEIR
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgtccggtttgccaccagggagaaatggtttctggcattaaagatattccatac
accttccgtggacgaaaaacagtattgaaaggtatccacggtttatattgtgtccattgc
gaagagagcatcatgaataaagaagagtcagatgctttcatggcgcaagtaaaggcattt
cgggcttcggtgaatgccgaaacagtggcacctgaatttatagtgaaggttcgaaaaaag
ctctctcttacccaaaaagaggcaagcgaaatttttgggggaggtgtaaatgcgttttcg
cgttacgaaaaaggcaatgcccaacctcatccttccacaatcaaacttttacgtgttctg
gataagcatccagaactattgaatgaaatccgttaa

DBGET integrated database retrieval system