KEGG   Escherichia coli K-12 W3110: JW3041
Entry
JW3041            CDS       T00068                                 

Gene name
yqjH
Definition
(GenBank) predicted siderophore interacting protein
  KO
K07229  ferric-chelate reductase (NADPH) [EC:1.16.1.9]
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    JW3041 (yqjH)
Enzymes [BR:ecj01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.9  ferric-chelate reductase (NADPH)
     JW3041 (yqjH)
SSDB
Motif
Pfam: FAD_binding_9 SIP
Other DBs
NCBI-ProteinID: BAE77120
UniProt: Q46871
Position
complement(3214383..3215147)
AA seq 254 aa
MNNTPRYPQRVRNDLRFRELTVLRVERISAGFQRIVLGGEALDGFTSRGFDDHSKLFFPQ
PDAHFVPPTVTEEGIVWPEGPRPPSRDYTPLYDELRHELAIDFFIHDGGVASGWAMQAQP
GDKLTVAGPRGSLVVPEDYAYQLYVCDESGMPALRRRLETLSKLAVKPQVSALVSVRDNA
CQDYLAHLDGFNIEWLAHDEQAVDARLAQMQIPADDYFIWITGEGKVVKNLSRRFEAEQY
DPQRVRAAAYWHAK
NT seq 765 nt   +upstreamnt  +downstreamnt
atgaataacaccccccgctacccgcagcgcgttcgcaatgatctgcgcttccgtgaactg
actgtgttacgcgttgagcgcatcagcgccggttttcagcgcattgtcctcggcggcgag
gcgctggacggttttacatcgcgtggctttgacgatcacagcaaactcttctttcctcaa
cctgacgctcactttgtgccgccaacggtaacggaagagggcatcgtctggccggaagga
ccacgcccaccgtcgcgtgactatacgccgctgtatgacgaactacgccatgaactggcg
attgatttctttattcacgacggtggggtcgccagcggctgggcgatgcaggcgcaaccg
ggcgataaacttacggtggcaggtccgcgcggttcgctggtggtgccggaagattacgcg
tatcagctgtatgtctgcgatgaatccggaatgcctgcattgcgccgccgcctggaaacg
ttgagcaaacttgccgttaaaccgcaagttagtgcgctggttagcgtgcgggataacgcc
tgtcaggattatctcgcgcaccttgatggttttaatatcgaatggctggcacatgatgag
caggcggtagatgcgcgtctggcgcagatgcaaatccctgccgatgattacttcatctgg
ataaccggcgaaggtaaagtcgttaagaatttaagccgccgctttgaagcggaacagtat
gacccacagcgggtacgtgcagcggcttactggcacgcaaagtaa

DBGET integrated database retrieval system