KEGG   Escherichia coli K-12 W3110: JW3064
Entry
JW3064            CDS       T00068                                 

Symbol
exuT
Name
(GenBank) hexuronate transporter
  KO
K08191  MFS transporter, ACS family, hexuronate transporter
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW3064 (exuT)
Transporters [BR:ecj02000]
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    JW3064 (exuT)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-ProteinID: BAE77143
UniProt: P0AA78
Position
3243760..3245178
AA seq 472 aa
MATFGACRFFFGYPVVTNIFSLWRDDGRASCGYNKTMRFYMRKIKGLRWYMIALVTLGTV
LGYLTRNTVAAAAPTLMEELNISTQQYSYIIAAYSAAYTVMQPVAGYVLDVLGTKIGYAM
FAVLWAVFCGATALAGSWGGLAVARGAVGAAEAAMIPAGLKASSEWFPAKERSIAVGYFN
VGSSIGAMIAPPLVVWAIVMHSWQMAFIISGALSFIWAMAWLIFYKHPRDQKHLTDEERD
YIINGQEAQHQVSTAKKMSVGQILRNRQFWGIALPRFLAEPAWGTFNAWIPLFMFKVYGF
NLKEIAMFAWMPMLFADLGCILGGYLPPLFQRWFGVNLIVSRKMVVTLGAVLMIGPGMIG
LFTNPYVAIMLLCIGGFAHQALSGALITLSSDVFGRNEVATANGLTGMSAWLASTLFALV
VGALADTIGFSPLFAVLAVFDLLGALVIWTVLQNKPAIEVAQETHNDPAPQH
NT seq 1419 nt   +upstreamnt  +downstreamnt
atggcaacgttcggggcgtgccggttttttttcggttacccggtcgtaactaacatcttc
agcctctggcgggatgatggccgcgcttcctgcggatataacaaaacgatgaggttttac
atgcgtaaaattaaagggttacgttggtatatgatcgcactggtgacgctcggcaccgtg
cttggttacctgacgcgtaacactgtggcggcagctgcgccaactctgatggaagagtta
aacatctccacccaacagtattcctatatcatcgcagcctattctgctgcttatacggtc
atgcaaccggtagcaggttatgtactggatgtgctgggtacgaaaatcggttatgcaatg
tttgctgtgctgtgggccgtgttctgtggtgcaaccgcgctggcaggtagctggggtggc
ctggctgttgctcgtggtgcggtcggtgccgcggaagcagcgatgatcccggcgggtctg
aaagccagctccgaatggttcccggcgaaagagcgttccatcgcagtaggctactttaac
gtaggttcttcgattggtgcgatgattgcgccgccgctggtggtatgggcaatcgtaatg
cacagctggcagatggcatttatcatctccggtgcattgagctttatctgggcgatggca
tggctgattttctataaacatccgcgcgaccagaagcatctgaccgatgaagaacgcgac
tatattattaatggtcaggaagcccagcaccaggtgagcacggcgaagaaaatgtccgtt
ggtcagatcctgcgtaaccgtcagttctggggtatcgcgctgccgcgtttcctggcagaa
ccggcctggggtacttttaacgcgtggatcccgctgttcatgtttaaagtttacggcttt
aacctgaaagagatcgcgatgttcgcctggatgccgatgctgtttgctgacctcggttgt
atcctcggtggttacctgccgccgctgttccagcgttggtttggtgtgaacctgatcgtt
tcccgtaagatggtcgtaacgctgggtgcagtgctgatgattggcccgggtatgatcggc
ctgttcaccaacccgtatgtcgcaattatgctgctgtgtatcggtggttttgcccaccag
gcactgtctggcgcgctgattacgctctcttccgatgtgtttggtcgtaacgaagtggca
acggcaaacggtttaaccgggatgtccgcatggctggcaagtacgctgtttgcgctggtt
gtcggtgcactggctgacaccatcggcttcagcccgctgttcgcagttctggcagtgttc
gacctgttaggtgcgctggttatctggaccgtgttgcagaacaaaccggcgattgaggtg
gcgcaggaaacacataacgatcccgcaccgcaacattaa

DBGET integrated database retrieval system