KEGG   Escherichia coli K-12 W3110: JW3108Help
Entry
JW3108            CDS       T00068                                 

Gene name
agaC
Definition
(GenBank) N-acetylgalactosamine-specific enzyme IIC component of PTS
  KO
K10985  PTS system, galactosamine-specific IIC component
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00052  Galactose metabolism
ecj02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    JW3108 (agaC)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    JW3108 (agaC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW3108 (agaC)
Transporters [BR:ecj02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Galactosamine-specific II component [MD:M00287]
    JW3108 (agaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EII-Sor
Motif
Other DBs
NCBI-ProteinID: BAE77185
UniProt: P42910
Position
3284540..3285343
Genome map
AA seq 267 aa AA seqDB search
MHEITLLQGLSLAALVFVLGIDFWLEALFLFRPIIVCTLTGAILGDIQTGLITGGLTELA
FAGLTPAGGVQPPNPIMAGLMTTVIAWSTGVDAKTAIGLGLPFSLLMQYVILFFYSAFSL
FMTKADKCAKEADTAAFSRLNWTTMLIVASAYAVIAFLCTYLAQGAMQALVKAMPAWLTH
GFEVAGGILPAVGFGLLLRVMFKAQYIPYLIAGFLFVCYIQVSNLLPVAVLGAGFAVYEF
FNAKSRQQAQPQPVASKNEEEDYSNGI
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaaataaccctacttcagggattatccctggcggcgttagtttttgttctgggg
attgatttttggctggaagccttatttttattccgcccgataatcgtttgtaccctaact
ggcgctattctcggtgatattcagactggcttaattaccggtggtctgacagagttggct
ttcgccggattaacccctgcaggtggtgttcagccgcccaacccgattatggcgggtctg
atgaccaccgtcattgcatggtctacgggcgttgatgccaaaacagcaattggtcttggc
ctgccgtttagtttgttaatgcagtacgtcattctgttcttctattccgctttctcatta
tttatgaccaaagccgataaatgcgcgaaagaggcggatacggcagcgttttcccggctt
aactggacaacgatgctcatcgtcgcttcagcgtatgcggtgattgctttcctctgtact
tacctggcacagggggcgatgcaggcgctggtgaaagcgatgcccgcctggctgacccac
ggctttgaagtggctggcggtattctgcctgccgttggttttggcttgctgctgcgcgta
atgttcaaagcgcaatatatcccttacctgatcgccggtttcctgtttgtttgctacatc
caggtcagcaacctgttgccggttgccgtactgggcgcaggctttgcggtgtatgagttt
ttcaatgcgaaatcccggcagcaagcgcaaccgcagcccgttgccagtaaaaatgaagaa
gaggactacagcaatgggatctga

DBGET integrated database retrieval system