KEGG   Escherichia coli K-12 W3110: JW3157
Entry
JW3157            CDS       T00068                                 

Gene name
yrbA
Definition
(GenBank) predicted DNA-binding transcriptional regulator
Organism
ecj  Escherichia coli K-12 W3110
SSDB
Motif
Pfam: BolA DUF3206 Annexin_like
Other DBs
NCBI-ProteinID: BAE77234
UniProt: P0A9W6
Structure
PDB: 
1NY8

Position
complement(3336404..3336658)
AA seq 84 aa
MENNEIQSVLMNALSLQEVHVSGDGSHFQVIAVGELFDGMSRVKKQQTVYGPLMEYIADN
RIHAVSIKAYTPAEWARDRKLNGF
NT seq 255 nt   +upstreamnt  +downstreamnt
atggaaaataatgaaattcagagcgtgttgatgaacgctctctccctccaggaagtccac
gtttccggcgatggcagccactttcaggttattgccgtgggtgagttgtttgacggcatg
agtcgggttaaaaaacagcagacggtctatggtccgctgatggaatatattgcggataac
cgcattcatgctgtgtcgatcaaagcgtatacccctgcggagtgggcgcgcgatcgcaaa
ctgaacggcttttga

DBGET integrated database retrieval system