KEGG   Escherichia coli K-12 W3110: JW3160Help
Entry
JW3160            CDS       T00068                                 

Gene name
yrbD
Definition
(GenBank) predicted ABC-type organic solvent transporter
  KO
K02067  phospholipid/cholesterol/gamma-HCH transport system substrate-binding protein
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    JW3160 (yrbD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW3160 (yrbD)
Transporters [BR:ecj02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   gamma-Hexachlorocyclohexane transporter
    JW3160 (yrbD)
   Phospholipid transporter
    JW3160 (yrbD)
   Mce system transporter
    JW3160 (yrbD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MlaD
Motif
Other DBs
NCBI-ProteinID: BAE77237
UniProt: P64604
Structure
PDB: 

Position
complement(3337765..3338316)
Genome map
AA seq 183 aa AA seqDB search
MQTKKNEIWVGIFLLAALLAALFVCLKAANVTSIRTEPTYTLYATFDNIGGLKARSPVSI
GGVVVGRVADITLDPKTYLPRVTLEIEQRYNHIPDTSSLSIRTSGLLGEQYLALNVGFED
PELGTAILKDGDTIQDTKSAMVLEDLIGQFLYGSKGDDNKNSGDAPAAAPGNNETTEPVG
TTK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgaaaaaaaatgaaatttgggtgggtatctttttattagcagcactgctggcg
gcgctgtttgtttgcctgaaggcggcgaacgtgacgtccatacgtactgaaccgacctac
acgctttatgcgacgttcgataacattggcggcctgaaagcgcgctctccggtcagtatt
ggtggcgttgttgtgggtcgggtggcggatattacgctggacccgaaaacctatctgccg
cgcgtaacgctggaaattgaacaacgttataaccacattccagataccagttcgctgagc
attcgtacttccggcctgctgggggaacaatatctggcattaaacgtcggttttgaagac
ccggaactggggactgctatcctgaaggatggcgatacaattcaggacactaagtctgcg
atggtgctggaagatctcattggtcagttcctttacggtagtaaaggcgatgacaataag
aatagtggcgatgcgccagctgctgcgccaggtaataatgaaaccactgaacctgtgggt
acaacgaaataa

DBGET integrated database retrieval system