KEGG   Escherichia coli K-12 W3110: JW3193
Entry
JW3193            CDS       T00068                                 

Symbol
nanT
Name
(GenBank) sialic acid transporter
  KO
K03290  MFS transporter, SHS family, sialic acid transporter
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW3193 (nanT)
Transporters [BR:ecj02000]
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Sialate:H+ symporter (SHS) family [TC:2.A.1.12]
    JW3193 (nanT)
SSDB
Motif
Pfam: MFS_1 Sugar_tr UPF0029
Other DBs
NCBI-ProteinID: BAE77267
UniProt: P41036
Position
complement(3370939..3372429)
AA seq 496 aa
MSTTTQNIPWYRHLNRAQWRAFSAAWLGYLLDGFDFVLIALVLTEVQGEFGLTTVQAASL
ISAAFISRWFGGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGM
GMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIG
ILPIIFALWLRKNIPEAEDWKEKHAGKAPVRTMVDILYRGEHRIANIVMTLAAATALWFC
FAGNLQNAAIVAVLGLLCAAIFISFMVQSAGKRWPTGVMLMVVVLFAFLYSWPIQALLPT
YLKTDLAYNPHTVANVLFFSGFGAAVGCCVGGFLGDWLGTRKAYVCSLLASQLLIIPVFA
IGGANVWVLGLLLFFQQMLGQGIAGILPKLIGGYFDTDQRAAGLGFTYNVGALGGALAPI
IGALIAQRLDLGTALASLSFSLTFVVILLIGLDMPSRVQRWLRPEALRTHDAIDGKPFSG
AVPFGSAKNDLVKTKS
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgagtactacaacccagaatatcccgtggtatcgccatctcaaccgtgcacaatggcgc
gcattttccgctgcctggttgggatatctgcttgacggttttgatttcgttttaatcgcc
ctggtactcaccgaagtacaaggtgaattcgggctgacgacggtgcaggcggcaagtctg
atctctgcagcctttatctctcgctggttcggcggcctgatgctcggcgctatgggtgac
cgctacgggcgtcgtctggcaatggtcaccagcatcgttctcttctcggccgggacgctg
gcctgcggctttgcgccaggctacatcaccatgtttatcgctcgtctggtcatcggcatg
gggatggcgggtgaatacggttccagcgccacctatgtcattgaaagctggccaaaacat
ctgcgtaacaaagccagtggttttttgatttcaggcttctctgtgggggccgtcgttgcc
gctcaggtctatagcctggtggttccggtctggggctggcgtgcgctgttctttatcggc
attttgccaatcatctttgctctctggctgcgtaaaaacatcccggaagcggaagactgg
aaagagaaacacgcaggtaaagcaccagtacgcacaatggtggatattctctaccgtggt
gaacatcgcattgccaatatcgtaatgacactggcggcggctactgcgctgtggttctgc
ttcgccggtaacctgcaaaatgccgcgatcgtcgctgttcttgggctgttatgcgccgca
atctttatcagctttatggtgcagagtgcaggcaaacgctggccaacgggcgtaatgctg
atggtggtcgtgttgtttgctttcctctactcatggccgattcaggcgctgctgccaacg
tatctgaaaaccgatctggcttataacccgcatactgtagccaatgtgctgttctttagt
ggctttggcgcggcggtgggatgctgcgtaggtggcttcctcggtgactggctgggaacc
cgcaaagcgtacgtttgtagcctgctggcctcgcagctgctgattattccggtatttgcg
attggcggcgcaaacgtctgggtgctcggtctgttactgttcttccagcaaatgcttgga
caagggatcgccgggatcttaccaaaactgattggcggttatttcgataccgaccagcgt
gcagcgggcctgggctttacctacaacgttggcgcattgggcggtgcactggccccaatc
atcggcgcgttgatcgctcaacgtctggatctgggtactgcgctggcatcgctctcgttc
agtctgacgttcgtggtgatcctgctgattgggctggatatgccttctcgcgttcagcgt
tggttgcgcccggaagcgttgcgtactcatgacgctatcgacggtaaaccattcagcggt
gccgtgccgtttggcagcgccaaaaacgatttagtcaaaaccaaaagttaa

DBGET integrated database retrieval system