KEGG   Escherichia coli K-12 W3110: JW3226Help
Entry
JW3226            CDS       T00068                                 

Gene name
panF
Definition
(GenBank) pantothenate:sodium symporter
  KO
K14392  sodium/pantothenate symporter
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW3226 (panF)
Transporters [BR:ecj02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   JW3226 (panF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSF
Motif
Other DBs
NCBI-ProteinID: BAE77299
UniProt: P16256
Position
3407462..3408913
Genome map
AA seq 483 aa AA seqDB search
MQLEVILPLVAYLVVVFGISVYAMRKRSTGTFLNEYFLGSRSMGGIVLAMTLTATYISAS
SFIGGPGAAYKYGLGWVLLAMIQLPAVWLSLGILGKKFAILARRYNAVTLNDMLFARYQS
RLLVWLASLSLLVAFVGAMTVQFIGGARLLETAAGIPYETGLLIFGISIALYTAFGGFRA
SVLNDTMQGLVMLIGTVVLLIGVVHAAGGLSNAVQTLQTIDPQLVTPQGADDILSPAFMT
SFWVLVCFGVIGLPHTAVRCISYKDSKAVHRGIIIGTIVVAILMFGMHLAGALGRAVIPD
LTVPDLVIPTLMVKVLPPFAAGIFLAAPMAAIMSTINAQLLQSSATIIKDLYLNIRPDQM
QNETRLKRMSAVITLVLGALLLLAAWKPPEMIIWLNLLAFGGLEAVFLWPLVLGLYWERA
NAKGALSAMIVGGVLYAVLATLNIQYLGFHPIVPSLLLSLLAFLVGNRFGTSVPQATVLT
TDK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttgaagtaattctaccgctggtcgcctatctggtggtggtgttcggtatctcg
gtttatgcgatgcgtaaacggagcaccggcaccttccttaatgagtatttcctcggcagc
cgctctatgggcggtattgtgctggcgatgacgctcaccgcgacctatatcagtgccagt
tcgtttatcggcgggccaggagctgcttataaatacgggctgggctgggtattgctggcg
atgattcagcttcctgcagtctggctttcactcggtattctcggcaagaagtttgcgatt
cttgcgcgccgctacaatgcagtgacgctgaacgatatgctgtttgcccgctaccagagt
cgtcttctggtgtggctggcgagtttgagtttgctggttgcgttcgttggtgcgatgacc
gtgcagtttatcggcggtgcgcgcctgctggaaaccgcggcgggtattccttatgaaacc
gggctgctgatttttggtatcagcattgcgttatataccgcctttggtggctttcgcgcc
agcgtgctgaacgacaccatgcaagggcttgtgatgctgattggcaccgttgtgctgctt
attggcgtagtacatgccgctggcggcttaagtaacgcagtacagaccttgcaaaccatc
gatccgcaactggttacgccacaaggcgctgacgatattctgtcgcctgcctttatgacg
tcgttctgggtactggtgtgttttggcgtgattggcctgccgcatactgcggtgcgctgt
atctcttataaagacagcaaagccgtacatcgggggatcatcatcggtacgattgtggtc
gcaattctgatgttcggtatgcacctggccggagcgttaggtcgggcggtgatccccgat
ctcaccgtaccggacctggtgatcccaacgttaatggtaaaagtgctgccaccgtttgct
gccgggatcttcctggctgcaccgatggctgcgatcatgtcgacaattaacgcccaactg
ctgcaaagttccgctacgatcattaaagatctctatctgaatatccgtccggatcaaatg
caaaacgagacgcgtctgaagcggatgtcggcggtaattacgttagttctcggcgcgttg
ctgctgcttgccgcctggaagccgccagaaatgatcatctggctgaatttgttggccttc
ggtgggctggaagccgttttcctgtggccgctggtgctgggtctttactgggaacgcgcc
aacgccaaaggcgcgctaagtgcgatgatcgttggcggcgtgctgtatgccgtactcgcg
acgctgaatattcagtacctgggcttccaccctatcgtgccctcgttactactaagtttg
ctggctttcctggtcggaaaccgtttcggtacatccgtcccgcaagctaccgttttgact
actgataaataa

DBGET integrated database retrieval system