KEGG   Escherichia coli K-12 W3110: JW3251Help
Entry
JW3251            CDS       T00068                                 

Gene name
trkA
Definition
(GenBank) NAD-binding component of TrK potassium transporter
  KO
K03499  trk system potassium uptake protein
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW3251 (trkA)
Transporters [BR:ecj02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   JW3251 (trkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrkA_N TrkA_C F420_oxidored NAD_binding_7 Shikimate_DH Sacchrp_dh_NADP ApbA NAD_binding_2 3HCDH_N NAD_binding_10 NAD_Gly3P_dh_N AlaDh_PNT_C GFO_IDH_MocA Pyr_redox_2 Pyr_redox UDPG_MGDP_dh_N adh_short Epimerase XdhC_C DAO
Motif
Other DBs
NCBI-ProteinID: BAE78002
UniProt: P0AGI8
Position
complement(4202522..4203898)
Genome map
AA seq 458 aa AA seqDB search
MKIIILGAGQVGGTLAENLVGENNDITVVDTNGERLRTLQDKFDLRVVQGHGSHPRVLRE
AGADDADMLVAVTSSDETNMVACQVAYSLFNTPNRIARIRSPDYVRDADKLFHSDAVPID
HLIAPEQLVIDNIYRLIEYPGALQVVNFAEGKVSLAVVKAYYGGPLIGNALSTMREHMPH
IDTRVAAIFRHDRPIRPQGSTIVEAGDEVFFIAASQHIRAVMSELQRLEKPYKRIMLVGG
GNIGAGLARRLEKDYSVKLIERNQQRAAELAEKLQNTIVFFGDASDQELLAEEHIDQVDL
FIAVTNDDEANIMSAMLAKRMGAKKVMVLIQRRAYVDLVQGSVIDIAISPQQATISALLS
HVRKADIVGVSSLRRGVAEAIEAVAHGDESTSRVVGRVIDEIKLPPGTIIGAVVRGNDVM
IANDNLRIEQGDHVIMFLTDKKFITDVERLFQPSPFFL
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattatcattctgggtgccggccaggttggcggcacactggcggaaaacctggtt
ggcgagaacaacgatattactgttgtcgataccaacggtgagcgtctgcggaccttacag
gataaatttgacctgcgggtcgtgcaggggcatggctctcatccacgcgtattgcgggag
gcaggtgccgacgacgccgatatgctggttgctgtaaccagttcagatgaaaccaatatg
gttgcctgccaggtagcctactcacttttcaacacccctaatcgcatcgctcgtatccgc
tcaccagactacgtgcgcgatgccgataagctatttcattcagatgctgtgccgattgat
catctgatcgcaccagagcagttggttatcgataatatttaccgactgattgagtatccc
ggcgcattgcaggtggtgaacttcgctgagggtaaagtcagcctggctgtggttaaagcc
tattatggcggcccgctgattggtaatgcactttcgaccatgcgcgaacatatgccacat
atcgatactcgtgtggcagcaattttccgccacgatcgccccattcgtccgcaaggttcg
accattgttgaagctggtgatgaagtgttctttattgccgcttcacagcatatccgcgcg
gtgatgagtgaattacagcgactggaaaaaccgtataagcggatcatgctggttggtggc
ggtaatatcggtgcagggctggcgcgtcgtctggaaaaagattacagcgttaaactcatc
gaacgtaatcagcagcgcgctgccgaactggcggaaaagttacagaatacgatcgtcttt
tttggtgatgcgtcggatcaagaactactggccgaagaacatatcgatcaagttgatctg
tttattgccgtcaccaacgatgacgaggccaatatcatgtccgccatgcttgccaaacgt
atgggtgcgaaaaaggtgatggtattgatccagcgtcgcgcttatgtggatctggttcag
gggagcgttatcgatattgcgatttcaccacaacaagcaactatttctgcgttgcttagc
catgtgcgaaaagcagatattgttggtgtttcctcattgcgccgcggcgtagcagaagct
attgaagccgttgctcacggtgatgaaagcacctcacgcgttgtcggcagagtcattgac
gaaatcaagctaccgccaggaacgattattggagcggtggtacgtggaaacgacgtgatg
attgccaatgacaatctgcgcattgagcaaggcgatcacgtaattatgttcctcacagat
aaaaagtttattaccgacgtcgaaagactcttccagccaagccctttcttcttgtaa

DBGET integrated database retrieval system