KEGG   Escherichia coli K-12 W3110: JW3252
Entry
JW3252            CDS       T00068                                 

Symbol
mscL
Name
(GenBank) mechanosensitive channel
  KO
K03282  large conductance mechanosensitive channel
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW3252 (mscL)
Transporters [BR:ecj02000]
 Other transporters
  Pores ion channels [TC:1]
   JW3252 (mscL)
SSDB
Motif
Pfam: MscL OAD_gamma UPF0239 Ac110_PIF
Other DBs
NCBI-ProteinID: BAE78001
UniProt: P0A742
Structure
PDB: 
4LKU

Position
complement(4201982..4202392)
AA seq 136 aa
MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVT
LRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEV
LLTEIRDLLKEQNNRS
NT seq 411 nt   +upstreamnt  +downstreamnt
atgagcattattaaagaatttcgcgaatttgcgatgcgcgggaacgtggtggatttggcg
gtgggtgtcattatcggtgcggcattcgggaagattgtctcttcactggttgccgatatc
atcatgcctcctctgggcttattaattggcgggatcgattttaaacagtttgctgtcacg
ctacgcgatgcgcagggggatatccctgctgttgtgatgcattacggtgtcttcattcaa
aacgtctttgattttctgattgtggcctttgccatctttatggcgattaagctaatcaac
aaactgaatcggaaaaaagaagaaccagcagccgcacctgcaccaactaaagaagaagta
ttactgacagaaattcgtgatttgctgaaagagcagaataaccgctcttaa

DBGET integrated database retrieval system