KEGG   Escherichia coli K-12 W3110: JW3304Help
Entry
JW3304            CDS       T00068                                 

Gene name
rpsL
Definition
(GenBank) 30S ribosomal subunit protein S12
  KO
K02950  small subunit ribosomal protein S12
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    JW3304 (rpsL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ecj03011]
    JW3304 (rpsL)
Ribosome [BR:ecj03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    JW3304 (rpsL)
  Bacteria
    JW3304 (rpsL)
  Archaea
    JW3304 (rpsL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosom_S12_S23 Ribosomal_S12
Motif
Other DBs
NCBI-ProteinID: BAE77949
UniProt: P0A7S3
Structure
PDB: 

Position
4165864..4166238
Genome map
AA seq 124 aa AA seqDB search
MATVNQLVRKPRARKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNG
FEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVK
RPKA
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagttaaccagctggtacgcaaaccacgtgctcgcaaagttgcgaaaagcaac
gtgcctgcgctggaagcatgcccgcaaaaacgtggcgtatgtactcgtgtatatactacc
actcctaaaaaaccgaactccgcgctgcgtaaagtatgccgtgttcgtctgactaacggt
ttcgaagtgacttcctacatcggtggtgaaggtcacaacctgcaggagcactccgtgatc
ctgatccgtggcggtcgtgttaaagacctcccgggtgttcgttaccacaccgtacgtggt
gcgcttgactgctccggcgttaaagaccgtaagcaggctcgttccaagtatggcgtgaag
cgtcctaaggcttaa

DBGET integrated database retrieval system