KEGG   Escherichia coli K-12 W3110: JW3314Help
Entry
JW3314            CDS       T00068                                 

Gene name
kefG
Definition
(GenBank) component of potassium effux complex with KefB
  KO
K11748  glutathione-regulated potassium-efflux system ancillary protein KefG
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW3314 (kefG)
Transporters [BR:ecj02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   JW3314 (kefG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavodoxin_2 FMN_red
Motif
Other DBs
NCBI-ProteinID: BAE77939
UniProt: P0A756
Position
4159255..4159809
Genome map
AA seq 184 aa AA seqDB search
MMSQPAKVLLLYAHPESQDSVANRVLLKPATQLSNVTVHDLYAHYPDFFIDIPREQALLR
EHEVIVFQHPLYTYSCPALLKEWLDRVLSRGFASGPGGNQLAGKYWRSVITTGEPESAYR
YDALNRYPMSDVLRPFELAAGMCRMHWLSPIIIYWARRQSAQELASHARAYGDWLANPLS
PGGR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgatgtctcagccagcgaaagttttgctgctgtatgcccatccggaatctcaggactcg
gtggcaaaccgggtactgcttaaaccggccacgcagctcagcaatgttaccgtgcacgac
ctttacgcgcactatcccgatttttttattgatatcccccgtgagcaggcattactgcgc
gagcacgaggtgattgtctttcagcatcctctttatacctatagctgcccggcgctactg
aaagagtggctggaccgggtattaagtcgtggttttgccagcgggccgggaggaaaccaa
ctggcgggaaagtactggcgtagcgtgattaccaccggcgagccggaaagtgcttaccgt
tatgacgcgctgaatcgctacccgatgagcgatgtgctgcgcccctttgaactggcggcg
ggcatgtgccggatgcattggttaagtcccatcattatttactgggcgagacggcaaagc
gcacaggagctggcgagccacgccagagcctacggtgactggctggcaaatccgctgtct
ccaggaggccgctga

DBGET integrated database retrieval system