KEGG   Escherichia coli K-12 W3110: JW3330
Entry
JW3330            CDS       T00068                                 

Symbol
nirC
Name
(GenBank) nitrite transporter
  KO
K02598  nitrite transporter
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW3330 (nirC)
Transporters [BR:ecj02000]
 Other transporters
  Pores ion channels [TC:1]
   JW3330 (nirC)
SSDB
Motif
Pfam: Form_Nir_trans
Other DBs
NCBI-ProteinID: BAE77923
UniProt: P0AC26
Position
complement(4142607..4143413)
AA seq 268 aa
MFTDTINKCAANAARIARLSANNPLGFWVSSAMAGAYVGLGIILIFTLGNLLDPSVRPLV
MGATFGIALTLVIIAGSELFTGHTMFLTFGVKAGSISHGQMWAILPQTWLGNLVGSVFVA
MLYSWGGGSLLPVDTSIVHSVALAKTTAPAMVLFFKGALCNWLVCLAIWMALRTEGAAKF
IAIWWCLLAFIASGYEHSIANMTLFALSWFGNHSEAYTLAGIGHNLLWVTLGNTLSGAVF
MGLGYWYATPKANRPVADKFNQTETAAG
NT seq 807 nt   +upstreamnt  +downstreamnt
atgtttacagacactattaataagtgtgcggctaacgctgcgcgcattgcacgcctgtcg
gcaaataacccgctcggcttttgggtcagctccgccatggcgggcgcgtatgtgggtctt
gggatcatcctgattttcacgctcggtaatttgctcgatccatccgtacgccctttggtg
atgggcgcgacctttggtatcgccttaacgctggtgattatcgccggttctgaactgttc
accggacacaccatgttcctcacctttggggtaaaagcgggcagcatcagccacgggcaa
atgtgggcaatcctgccgcaaacctggctgggtaacctggtcggttccgtcttcgttgcc
atgctctatagctggggcggcggtagcctgctgccggtagataccagcatcgttcactcc
gtcgcgctggctaaaaccactgcaccggcaatggtactcttcttcaaaggtgcattgtgt
aactggctggtttgcctggcaatctggatggcgctgcgcactgaaggggcggcgaaattt
atcgctatctggtggtgtctgctggcatttatcgcgtccggctacgagcactctatcgct
aacatgacgctgttcgcgctctcctggttcggcaaccacagcgaagcctacacgctggcg
ggtattggtcataacctgctgtgggtgacgctgggtaatactttatcaggtgccgtattc
atgggattgggttattggtatgctacgccgaaagcgaatcgtccggttgcggacaaattt
aatcaaactgaaacggctgccggttaa

DBGET integrated database retrieval system