KEGG   Escherichia coli K-12 W3110: JW3384
Entry
JW3384            CDS       T00068                                 

Gene name
rtcB
Definition
(GenBank) conserved hypothetical protein
  KO
K14415  tRNA-splicing ligase RtcB (3'-phosphate/5'-hydroxy nucleic acid ligase) [EC:6.5.1.8]
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ecj03016]
    JW3384 (rtcB)
Enzymes [BR:ecj01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.8  3'-phosphate/5'-hydroxy nucleic acid ligase
     JW3384 (rtcB)
Transfer RNA biogenesis [BR:ecj03016]
 Eukaryotic type
  tRNA spricing factors
   tRNA splicing ligases
    JW3384 (rtcB)
 Prokaryotic type
    JW3384 (rtcB)
SSDB
Motif
Pfam: RtcB DUF4514
Other DBs
NCBI-ProteinID: BAE77871
UniProt: P46850
Position
4082337..4083563
AA seq 408 aa
MNYELLTTENAPVKMWTKGVPVEADARQQLINTAKMPFIFKHIAVMPDVHLGKGSTIGSV
IPTKGAIIPAAVGVDIGCGMNALRTALTAEDLPENLAELRQAIETAVPHGRTTGRCKRDK
GAWENPPVNVDAKWAELEAGYQWLTQKYPRFLNTNNYKHLGTLGTGNHFIEICLDESDQV
WIMLHSGSRGIGNAIGTYFIDLAQKEMQETLETLPSRDLAYFMEGTEYFDDYLKAVAWAQ
LFASLNRDAMMENVVTALQSITQKTVRQPQTLAMEEINCHHNYVQKEQHFGEEIYVTRKG
AVSARAGQYGIIPGSMGAKSFIVRGLGNEESFCSCSHGAGRVMSRTKAKKLFSVEDQIRA
TAHVECRKDAEVIDEIPMAYKDIDAVMAAQSDLVEVIYTLRQVVCVKG
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgaattacgaattactgaccactgaaaatgccccggtaaaaatgtggaccaaaggcgtg
ccggtagaggccgatgcgcgtcagcaacttattaatacggcgaagatgccgtttattttc
aaacatattgcggtaatgcctgatgtacacctgggtaaaggttccaccattggtagcgtg
atcccgaccaaaggggcgattattccggcggcggtgggcgtggatattggctgtggaatg
aacgcgctgcgtaccgcgttaacggcggaagacctgcctgaaaacctggcagagctgcgt
caggcgattgaaacggccgtgccgcacgggcgtaccactggccgttgtaaacgtgataaa
ggtgcctgggaaaatccacctgttaacgtcgatgctaaatgggctgagcttgaagccggt
tatcagtggttaacgcaaaaatatccccgtttcctgaataccaataactataaacacctg
ggaacgctgggaaccggtaaccactttattgaaatctgccttgatgagtcggaccaggtg
tggattatgctgcactccggttcacgcggaattggtaacgccatcgggacttactttatc
gatctggcacaaaaagagatgcaggaaacgcttgagacgttgccgtcgcgtgatctggcg
tactttatggaaggtacggaatactttgatgattacctgaaagccgtggcctgggcgcag
ctttttgccagccttaaccgcgatgcgatgatggaaaacgtggtaacggcattgcagagc
attacgcagaaaacggtcagacagccacaaacgctggcgatggaagagatcaactgtcac
cacaactatgtgcaaaaagaacagcactttggtgaagagatctacgtgacgcgtaaaggc
gcggtgtctgcgcgtgctggtcaatatggaattattcccggttcgatgggagcaaaaagc
tttatcgtccgtgggctgggaaatgaagagtcgttctgttcgtgcagccacggtgccggg
cgggtaatgagccgaactaaagcgaaaaaactgttcagcgtggaagatcaaattcgtgcc
accgcgcatgtggaatgccgtaaagatgccgaagtgatcgacgaaatcccgatggcgtat
aaagatattgatgcggtgatggcggcacaaagcgatctggtggaagttatctataccctg
cgtcaggtggtgtgcgtaaaaggataa

DBGET integrated database retrieval system