KEGG   Escherichia coli K-12 W3110: JW3416Help
Entry
JW3416            CDS       T00068                                 

Gene name
ugpE
Definition
(GenBank) glycerol-3-phosphate transporter subunit
  KO
K05815  sn-glycerol 3-phosphate transport system permease protein
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02010  ABC transporters
Module
ecj_M00198  Putative sn-glycerol-phosphate transport system
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    JW3416 (ugpE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW3416 (ugpE)
Transporters [BR:ecj02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative sn-Glycerol 3-phosphate transporter [MD:M00198]
    JW3416 (ugpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: BAE77842
UniProt: P10906
Position
4050388..4051233
Genome map
AA seq 281 aa AA seqDB search
MIENRPWLTIFSHTMLILGIAVILFPLYVAFVAATLDKQAVYAAPMTLIPGTHLLENIHN
IWVNGVGTNSAPFWRMLLNSFVMAFSITLGKITVSMLSAFAIVWFRFPLRNLFFWMIFIT
LMLPVEVRIFPTVEVIANLQMLDSYAGLTLPLMASATATFLFRQFFMTLPDELVEAARID
GASPMRFFCDIVFPLSKTNLAALFVITFIYGWNQYLWPLLIITDVDLGTTVAGIKGMIAT
GEGTTEWNSVMVAMLLTLIPPVVIVLVMQRAFVRGLVDSEK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgattgagaaccgtccgtggctgacgatattcagccataccatgctgatcctcgggatc
gcggtgatcctcttcccgctgtacgtggcgtttgtcgcggcgacgctggataaacaggcc
gtctatgccgcgccgatgacgctcatccccggcacacatctgctggaaaacatccacaac
atctgggtgaacggggtaggcacgaatagcgcgccgttctggcggatgttgcttaacagc
tttgtgatggcgttcagcattacgctcggcaaaattaccgtctcgatgctctcggcattt
gccattgtctggtttcgttttccgctacgtaacctcttcttctggatgatttttatcacc
ctgatgctgccggttgaagtacgtatcttcccgacggtggaagtcatcgccaacctgcag
atgctcgacagctacgccggtttaacgctgccgctgatggcctcggcgaccgctactttc
ctgttccgccagttctttatgacgctgccggatgagctggtggaagccgcgcggatcgac
ggcgcatcgccaatgcgcttcttttgcgacatcgtttttccgctctccaaaactaatctg
gcggcgctgtttgtgatcacctttatctacggctggaatcagtatttgtggccgttgttg
attattaccgatgtggatctcggcaccaccgtggcagggatcaaagggatgatcgctaca
ggcgaaggcaccacggaatggaactcagtgatggtggcgatgttgttaacgcttatccct
ccggtggtgattgttttagtgatgcagcgtgccttcgtgcgcggcctggtcgatagtgag
aaataa

DBGET integrated database retrieval system