KEGG   Escherichia coli K-12 W3110: JW3417
Entry
JW3417            CDS       T00068                                 

Symbol
ugpA
Name
(GenBank) glycerol-3-phosphate transporter subunit
  KO
K05814  sn-glycerol 3-phosphate transport system permease protein
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    JW3417 (ugpA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW3417 (ugpA)
Transporters [BR:ecj02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Putative sn-Glycerol 3-phosphate transporter
    JW3417 (ugpA)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-ProteinID: BAE77841
UniProt: P10905
Position
4049504..4050391
AA seq 295 aa
MSSSRPVFRSRWLPYLLVAPQLIITVIFFIWPAGEALWYSLQSVDPFGFSSQFVGLDNFV
TLFHDSYYLDSFWTTIKFSTFVTVSGLLVSLFFAALVEYIVRGSRFYQTLMLLPYAVAPA
VAAVLWIFLFNPGRGLITHFLAEFGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFYAA
LQSIPRSLIEAAAIDGAGPIRRFFKIALPLIAPVSFFLLVVNLVYAFFDTFPVIDAATSG
GPVQATTTLIYKIYREGFTGLDLASSAAQSVVLMFLVIVLTVVQFRYVESKVRYQ
NT seq 888 nt   +upstreamnt  +downstreamnt
atgtcatcatcccgtccggtgttccgctcgcgctggctgccttatctgctggtcgcgccg
cagctcatcatcaccgttatcttttttatctggcctgcgggcgaagcgttgtggtactcg
ctacaaagcgtcgatccgtttggtttctccagccagtttgtcggcctggataacttcgtc
acgctgttccatgacagctactatctcgactccttctggacgacgataaaattcagcacc
tttgtcaccgtcagcggtttgctggtatcgctgttctttgcggcgctggtggagtacatc
gtgcgcggcagccgtttctatcaaaccttaatgttgctgccttacgccgtggctcccgcc
gttgccgccgtattgtggatcttcctgtttaaccccggtcgcgggctgatcacccatttt
ctcgcggagttcggctacgactggaaccacgcgcaaaacagcggtcaggcaatgtttctg
gtggtgtttgcctcagtatggaagcaaatcagctacaacttcctgttcttctatgccgcg
ctgcaatccattccccgttcgttgatcgaagccgcagccatcgacggtgcagggccgatt
cgccgcttctttaagattgcgctgccgcttatcgccccggtgagtttcttcctgctggta
gtgaacctggtgtatgccttcttcgacaccttcccggtgatcgacgccgccacgtccggc
gggccggttcaggccaccacgacgctgatttataagatctaccgcgaaggttttaccgga
ctggatctggcttcgtctgccgcacagtcggtggtgttgatgttcctcgtcatcgtgctg
acggtggtgcagttccgctatgttgaaagcaaggtgcgttaccaatga

DBGET integrated database retrieval system