KEGG   Escherichia coli K-12 W3110: JW3423
Entry
JW3423            CDS       T00068                                 

Symbol
livK
Name
(GenBank) leucine transporter subunit
  KO
K01999  branched-chain amino acid transport system substrate-binding protein
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02010  ABC transporters
ecj02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    JW3423 (livK)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    JW3423 (livK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW3423 (livK)
Transporters [BR:ecj02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter
    JW3423 (livK)
SSDB
Motif
Pfam: Peripla_BP_6 ANF_receptor Peripla_BP_5 PGM_PMM_I Fe-ADH LppC
Other DBs
NCBI-ProteinID: BAE77835
UniProt: P04816
Structure
Position
4042855..4043964
AA seq 369 aa
MKRNAKTIIAGMIALAISHTAMADDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKG
GIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMI
SPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARS
VQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVG
LKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYV
WITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWH
ADGSSTAAK
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgaaacggaatgcgaaaactatcatcgcagggatgattgcactggcaatttcacacacc
gctatggctgacgatattaaagtcgccgttgtcggcgcgatgtccggcccgattgcccag
tggggcgatatggaatttaacggcgcgcgtcaggcaattaaagacattaatgccaaaggg
ggaattaagggcgataaactggttggcgtggaatatgacgacgcatgcgacccgaaacaa
gccgttgcggtcgccaacaaaatcgttaatgacggcattaaatacgttattggtcatctg
tgttcttcttctacccagcctgcgtcagatatctatgaagacgaaggtattctgatgatc
tcgccgggagcgaccaacccggagctgacccaacgcggttatcaacacattatgcgtact
gccgggctggactcttcccaggggccaacggcggcaaaatacattcttgagacggtgaag
ccccagcgcatcgccatcattcacgacaaacaacagtatggcgaagggctggcgcgttcg
gtgcaggacgggctgaaagcggctaacgccaacgtcgtcttcttcgacggtattaccgcc
ggggagaaagatttctccgcgctgatcgcccgcctgaaaaaagaaaacatcgacttcgtt
tactacggcggttactacccggaaatggggcagatgctgcgccaggcccgttccgttggc
ctgaaaacccagtttatggggccggaaggtgtgggtaatgcgtcgttgtcgaacattgcc
ggtgatgccgccgaaggcatgttggtcactatgccaaaacgctatgaccaggatccggca
aaccagggcatcgttgatgcgctgaaagcagacaagaaagatccgtccgggccttatgtc
tggatcacctacgcggcggtgcaatctctggcgactgcccttgagcgtaccggcagcgat
gagccgctggcgctggtgaaagatttaaaagctaacggtgcaaacaccgtgattgggccg
ctgaactgggatgaaaaaggcgatcttaagggatttgattttggtgtcttccagtggcac
gccgacggttcatccacggcagccaagtga

DBGET integrated database retrieval system