KEGG   Escherichia coli K-12 W3110: JW3440Help
Entry
JW3440            CDS       T00068                                 

Gene name
acpT
Definition
(GenBank) holo-(acyl carrier protein) synthase 2
  KO
K06133  4'-phosphopantetheinyl transferase [EC:2.7.8.-]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00770  Pantothenate and CoA biosynthesis
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    JW3440 (acpT)
Enzymes [BR:ecj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.-  
     JW3440 (acpT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACPS
Motif
Other DBs
NCBI-ProteinID: BAE77818
UniProt: P37623
Position
complement(4026859..4027446)
Genome map
AA seq 195 aa AA seqDB search
MYRIVLGKVSTLSAAPLPPGLREQAPQGPRRERWLAGRALLSHTLSPLPEIIYGEQGKPA
FAPEMPLWFNLSHSGDDIALLLSDEGEVGCDIEVIRPRANWRWLANAVFSLGEHAEMDAV
HPDQQLEMFWRIWTRKEAIVKQRGGSAWQIVSVDSTYHSSLSVSHCQLENLSLAICTPTP
FTLTADSVQWIDSVN
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtatcggatagttctggggaaagtttcgaccttaagcgcagctccactgccaccgggt
ttacgcgagcaagcaccgcaaggtccacgacgcgaacgctggctggcggggcgtgcattg
ctttcgcacacgctttccccgctaccggagatcatctatggcgaacaaggcaaacctgca
tttgcgccggaaatgccgctatggttcaacttaagccatagcggtgacgatatcgccctg
ctgttgagtgatgaaggcgaagtcggctgcgatatcgaagtgattcgcccgcgcgccaac
tggcgctggctggcgaacgccgtattcagcctcggggaacacgctgagatggacgccgtg
catcctgatcagcaactggaaatgttctggcgcatctggacgcgcaaagaagccatcgtt
aaacagcgtggcggcagcgcctggcaaatcgtcagcgtagacagcacctatcactcctcg
ctgtcagtcagccattgtcagcttgaaaatttaagccttgcgatctgcacccctactccc
tttacgctcaccgccgacagtgtgcaatggatcgattcagttaactga

DBGET integrated database retrieval system