KEGG   Escherichia coli K-12 W3110: JW3444Help
Entry
JW3444            CDS       T00068                                 

Gene name
nikD
Definition
(GenBank) nickel transporter subunit
  KO
K15587  nickel transport system ATP-binding protein [EC:7.2.2.11]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02010  ABC transporters
Module
ecj_M00440  Nickel transport system
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    JW3444 (nikD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW3444 (nikD)
Enzymes [BR:ecj01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.11  ABC-type Ni2+ transporter
     JW3444 (nikD)
Transporters [BR:ecj02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Nickel transporter [MD:M00440]
    JW3444 (nikD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_29 AAA_22 AAA_19
Motif
Other DBs
NCBI-ProteinID: BAE77814
UniProt: P33593
Position
complement(4022636..4023400)
Genome map
AA seq 254 aa AA seqDB search
MPQQIELRNIALQAAQPLVHGVSLTLQRGRVLALVGGSGSGKSLTCAATLGILPAGVRQT
AGEILADGKPVSPCALRGIKIATIMQNPRSAFNPLHTMHTHARETCLALGKPADDATLTA
AIEAVGLENAARVLKLYPFEMSGGMLQRMMIAMAVLCESPFIIADEPTTDLDVVAQARIL
DLLESIMQKQAPGMLLVTHDMGVVARLADDVAVMSDGKIVEQGDVETLFNAPKHTVTRSL
VSAHLALYGMELAS
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaacagattgaactacgtaatatcgcgctacaggccgcgcagccgctggtacac
ggtgtatcgttaaccctgcaacgcgggcgcgtgctggcgttagtcggcggtagcggcagc
gggaaatcattaacctgcgccgcaacgctgggcattttgcccgctggcgttcgccagacg
gcgggggaaattttagccgatggcaaaccggtttcgccttgcgccctgcgcggcatcaaa
attgccaccatcatgcagaacccgcgcagcgcctttaatccactgcacaccatgcacacc
cacgcgcgggaaacctgcctggcgttagggaaacccgccgatgacgctacgcttaccgct
gccatagaagcggtggggctggaaaacgccgcgcgcgtgctgaagctgtacccgttcgag
atgagcggcggcatgttgcagcgcatgatgattgcgatggcggtgctgtgtgaatcaccg
tttatcatcgccgatgaaccgaccaccgaccttgacgtggtagcacaggcgcgcatcctc
gatctgctggaaagcattatgcaaaaacaagcgccgggaatgctgctggtgacccatgat
atgggcgttgtggcgcgtctggcggatgacgtggcggtgatgtctgacggtaagattgtc
gaacagggcgatgtagaaacgctgtttaacgcccccaaacatacagtgacgcgcagcctg
gtttccgctcatctcgccctctacggtatggagctggcatcatga

DBGET integrated database retrieval system