KEGG   Escherichia coli K-12 W3110: JW3454
Entry
JW3454            CDS       T00068                                 

Gene name
yhiI
Definition
(GenBank) predicted HlyD family secretion protein
  KO
K01993  HlyD family secretion protein
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    JW3454 (yhiI)
SSDB
Motif
Pfam: HlyD_3 HlyD_D23 Biotin_lipoyl_2 HlyD Biotin_lipoyl PTS_EIIA_1 Peptidase_M23 DUF2605
Other DBs
NCBI-ProteinID: BAE77806
UniProt: P37626
Position
4009813..4010880
AA seq 355 aa
MDKSKRHLAWWVVGLLAVAAIVAWWLLRPAGVPEGFAVSNGRIEATEVDIASKIAGRIDT
ILVKEGKFVREGEVLAKMDTRVLQEQRLEAIAQIKEAQSAVAAAQALLEQRQSETRAAQS
LVNQRQAELDSVAKRHTRSRSLAQRGAISAQQLDDDRAAAESARAALESAKAQVSASKAA
IEAARTNIIQAQTRVEAAQATERRIAADIDDSELKAPRDGRVQYRVAEPGEVLAAGGRVL
NMVDLSDVYMTFFLPTEQAGTLKLGGEARLILDAAPDLRIPATISFVASVAQFTPKTVET
SDERLKLMFRVKARIPPELLQQHLEYVKTGLPGVAWVRVNEELPWPDDLVVRLPQ
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggataagagtaagcgccatctggcgtggtgggttgtcgggttactggcggtggcggct
atcgtggcgtggtggctgttgcgcccggcaggtgtgccggaaggctttgctgtcagtaat
gggcgcattgaagcgacggaagtggatattgccagcaaaattgccgggcgtatcgacacc
attctggtgaaagaaggcaagtttgttcgcgaaggtgaagtgctggcgaagatggatact
cgcgtgttgcaggaacagcgactggaagccatcgcgcaaatcaaagaggcacaaagcgcc
gttgctgccgcgcaggctttgctggagcaacgacaaagcgaaactcgtgccgcacagtcg
ctggttaatcaacgccaggcagaactggactccgtagcaaaacgtcatacgcgttcccgt
tcactggcccaacgaggggctatttctgcgcaacagctggatgacgatcgcgccgccgct
gagagcgcccgagctgcgctggaatcggcgaaagctcaggtatcggcttctaaagcggct
atagaagcggcacgcaccaatatcattcaggcgcaaacccgcgtcgaagcggcacaagcc
actgaacggcgcattgccgcagatatcgatgacagcgaactgaaagccccgcgtgacgga
cgcgtgcagtatcgggttgccgagccaggcgaagtgctggcggcaggcggtcgggtgctg
aatatggtcgatctcagcgacgtctatatgactttcttcctgccaaccgaacaggcgggc
acgctgaaactgggcggtgaagcccggctgatcctcgatgccgcgccagatctgcgtatt
cctgcaaccatcagttttgtcgccagtgtcgcccagttcacgccaaaaaccgtcgaaacc
agcgatgaacggctgaaactgatgttccgcgtcaaagcgcgtatcccaccggaattactc
cagcagcatctggaatatgtcaaaaccggtttgccgggcgtagcgtgggtgcgggtgaat
gaagaacttccgtggcctgacgacctcgtggtgaggttgccgcaatga

DBGET integrated database retrieval system