KEGG   Escherichia coli K-12 W3110: JW3460Help
Entry
JW3460            CDS       T00068                                 

Gene name
pitA
Definition
(GenBank) phosphate transporter, low-affinity
  KO
K16322  low-affinity inorganic phosphate transporter
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW3460 (pitA)
Transporters [BR:ecj02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   JW3460 (pitA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1
Motif
Other DBs
NCBI-ProteinID: BAE77801
UniProt: P0AFJ7
Position
complement(4001274..4002773)
Genome map
AA seq 499 aa AA seqDB search
MLHLFAGLDLHTGLLLLLALAFVLFYEAINGFHDTANAVATVIYTRAMRSQLAVVMAAVF
NFLGVLLGGLSVAYAIVHMLPTDLLLNMGSSHGLAMVFSMLLAAIIWNLGTWYFGLPASS
SHTLIGAIIGIGLTNALMTGTSVVDALNIPKVLSIFGSLIVSPIVGLVFAGGLIFLLRRY
WSGTKKRARIHLTPAEREKKDGKKKPPFWTRIALILSAIGVAFSHGANDGQKGIGLVMLV
LIGVAPAGFVVNMNATGYEITRTRDAINNVEAYFEQHPALLKQATGADQLVPAPEAGATQ
PAEFHCHPSNTINALNRLKGMLTTDVESYDKLSLDQRSQMRRIMLCVSDTIDKVVKMPGV
SADDQRLLKKLKSDMLSTIEYAPVWIIMAVALALGIGTMIGWRRVATTIGEKIGKKGMTY
AQGMSAQMTAAVSIGLASYTGMPVSTTHVLSSSVAGTMVVDGGGLQRKTVTSILMAWVFT
LPAAVLLSGGLYWLSLQFL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgctacatttgtttgctggcctggatttgcataccgggctgttattattgcttgcactg
gcttttgtgctgttctacgaagccatcaatggtttccatgacacagccaacgccgtggca
accgttatctatacccgcgcgatgcgttctcagctcgccgtggttatggcggcggtattc
aactttttgggtgttttgctgggtggtctgagtgttgcctatgccattgtgcatatgctg
ccgacggatctgctgcttaatatgggatcgtctcatggccttgccatggtgttctctatg
ttgctggcggcgattatctggaacctgggtacctggtactttggtttacctgcatccagc
tctcatacgctgattggcgcgatcatcgggattggtttaaccaatgcgttgatgaccggg
acgtcagtggtggatgcactcaatatcccgaaagtattaagtattttcggttctctgatc
gtttcccctattgtcggcctggtgtttgctggcggtctgattttcttgctgcgtcgctac
tggagcggcaccaagaaacgcgcccgtatccacctgaccccagcggagcgtgaaaagaaa
gacggcaagaaaaagccgccgttctggacgcgtattgcgctgatcctttccgctatcggc
gtggcgttttcgcacggcgcgaacgatggtcagaaaggcattggtctggttatgttggta
ttgattggcgtcgcgccagcaggcttcgtggtgaacatgaatgccactggctacgaaatc
acccgtacccgtgatgccatcaacaacgtcgaagcttactttgagcagcatcctgcgctg
ctcaaacaggctaccggtgctgatcagttagtaccggctccggaagctggcgcaacgcaa
cctgcggagttccactgccatccgtcgaataccattaacgcgctcaaccgcctgaaaggt
atgttgaccaccgatgtggaaagctacgacaagctgtcgcttgatcaacgtagccagatg
cgccgcattatgctgtgcgtttctgacactatcgacaaagtggtgaagatgcctggcgtg
agtgctgacgatcagcgcctgttgaagaaactgaagtccgacatgcttagcaccatcgag
tatgcaccggtgtggatcatcatggcggtcgcgctggcgttaggtatcggtacgatgatt
ggctggcgccgtgtggcaacgactatcggtgagaaaatcggtaagaaaggcatgacctac
gctcaggggatgtctgcccagatgacggcggcagtgtctatcggcctggcgagttatacc
gggatgccggtttccactactcacgtactctcctcttctgtcgcggggacgatggtggta
gatggtggcggcttacagcgtaaaaccgtgaccagcattctgatggcctgggtgtttacc
cttccggctgcggtactgctttccggcgggctgtactggctctccttgcagttcctgtaa

DBGET integrated database retrieval system