KEGG   Escherichia coli K-12 W3110: JW3461Help
Entry
JW3461            CDS       T00068                                 

Gene name
yhiO
Definition
(GenBank) predicted universal stress (ethanol tolerance) protein B
  KO
K06144  universal stress protein B
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW3461 (yhiO)
Transporters [BR:ecj02000]
 Other transporters
  Others
   JW3461 (yhiO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UspB
Motif
Other DBs
NCBI-ProteinID: BAE77800
UniProt: P0A8S5
Position
4000695..4001030
Genome map
AA seq 111 aa AA seqDB search
MISTVALFWALCVVCIVNMARYFSSLRALLVVLRNCDPLLYQYVDGGGFFTSHGQPNKQV
RLVWYIYAQRYRDHHDDEFIRRCERVRRQFILTSALCGLVVVSLIALMIWH
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgataagcaccgtcgcattattttgggctttatgtgtcgtttgcattgttaacatggcg
cgctatttctcatcactacgcgcgttgttagtggtactgcgtaactgcgatccattgctc
tatcaatatgttgatggagggggcttttttacctcacatggccaacccaacaaacaggtg
cgtctcgtttggtatatctatgcccaacgttatcgcgatcatcacgatgatgaatttatt
cgccgctgtgagcgggtgcgtcggcagtttattctgaccagcgcattgtgtggtctggtg
gtggtcagcctgattgcattgatgatttggcattaa

DBGET integrated database retrieval system