KEGG   Escherichia coli K-12 W3110: JW3491
Entry
JW3491            CDS       T00068                                 

Gene name
yhjE
Definition
(GenBank) predicted transporter
Organism
ecj  Escherichia coli K-12 W3110
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-ProteinID: BAE77771
UniProt: P37643
Position
complement(3964307..3965629)
AA seq 440 aa
MQATATTLDHEQEYTPINSRNKVLVASLIGTAIEFFDFYIYATAAVIVFPHIFFPQGDPT
AATLQSLATFAIAFVARPIGSAVFGHFGDRVGRKATLVASLLTMGISTVVIGLLPGYATI
GIFAPLLLALARFGQGLGLGGEWGGAALLATENAPPRKRALYGSFPQLGAPIGFFFANGT
FLLLSWLLTDEQFMSWGWRVPFIFSAVLVIIGLYVRVSLHESPVFEKVAKAKKQVKIPLG
TLLTKHVRVTVLGTFIMLATYTLFYIMTVYSMTFSTAAAPVGLGLPRNEVLWMLMMAVIG
FGVMVPVAGLLADAFGRRKSMVIITTLIILFALFAFNPLLGSGNPILVFAFLLLGLSLMG
LTFGPMGALLPELFPTEVRYTGASFSYNVASILGASVAPYIAAWLQTNYGLGAVGLYLAA
MAGLTLIALLLTHETRHQSL
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgcaagcaacagccacaacactcgaccacgagcaagaatacacgccgatcaactcgcgt
aataaagtccttgtcgcctctctcattggcacagccattgagttcttcgacttttacatt
tacgccactgcggccgttattgtgtttccgcatatcttcttcccgcagggcgatcctacg
gcagcaacgctacagtcgctcgccaccttcgccatcgccttcgtcgcgcgccccattggc
tctgccgtttttggtcattttggcgatcgcgttgggcgtaaagcgacgctggtcgcctcg
ttgctaacgatggggatttcgaccgtggtgattggtctgctgccgggctatgccacgatt
ggtattttcgccccgctgctgctggcgctggctcgatttggtcagggtctgggcttaggc
ggtgaatggggcggcgcggcgctgctggcgactgaaaacgccccaccgcgcaaacgtgca
ctgtatggctcctttccgcagctgggcgcaccgattggcttcttctttgccaatggcact
ttcttgctgctttcctggctactgaccgacgagcagtttatgagctggggctggcgtgtg
ccatttatcttctcggcggtgctggtcattatcggcctgtatgttcgcgtgtcgctgcat
gagtcgccggtgtttgagaaagtcgctaaagcgaaaaaacaggtgaagatcccgctgggt
acgctgctgaccaaacatgttcgcgtaaccgtactgggtacgttcattatgctggcaacc
tatacgctgttttacatcatgacggtctactctatgacctttagtaccgccgccgcgcca
gttgggcttggcctgccgcgtaacgaagtgttgtggatgttgatgatggcagttattggt
tttggcgtgatggtgccagtcgctggattactggctgatgcctttggtcgccgtaaaagc
atggtaatcatcaccacgctgatcatcctgttcgcgctgttcgcctttaacccactgctc
ggttctggcaacccgattctggtttttgccttcctgctgctggggttaagtctgatgggt
ctgaccttcgggccaatgggtgcgctgttaccagagctgtttccgacagaagtgcgttac
accggagcatcgttctcttacaacgtagcgtcgattctcggggcttccgttgcgccatat
atcgcagcctggttgcagactaactacgggctaggtgcggtggggttatatctggcggcg
atggctggcttgacgttaatcgccctgctgctgacccatgagacgcgacatcagtcgttg
taa

DBGET integrated database retrieval system