KEGG   Escherichia coli K-12 W3110: JW3518
Entry
JW3518            CDS       T00068                                 

Gene name
tag
Definition
(GenBank) 3-methyl-adenine DNA glycosylase I, constitutive
  KO
K01246  DNA-3-methyladenine glycosylase I [EC:3.2.2.20]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    JW3518 (tag)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ecj03400]
    JW3518 (tag)
Enzymes [BR:ecj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.20  DNA-3-methyladenine glycosylase I
     JW3518 (tag)
DNA repair and recombination proteins [BR:ecj03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     JW3518 (tag)
SSDB
Motif
Pfam: Adenine_glyco YopE_N RBD
Other DBs
NCBI-ProteinID: BAE77746
UniProt: P05100
Structure
PDB: 
1P7M 1NKU 1LMZ

Position
complement(3926760..3927323)
AA seq 187 aa
MERCGWVSQDPLYIAYHDNEWGVPETDSKKLFEMICLEGQQAGLSWITVLKKRENYRACF
HQFDPVKVAAMQEEDVERLVQDAGIIRHRGKIQAIIGNARAYLQMEQNGEPFVDFVWSFV
NHQPQVTQATTLSEIPTSTSASDALSKALKKRGFKFVGTTICYSFMQACGLVNDHVVGCC
CYPGNKP
NT seq 564 nt   +upstreamnt  +downstreamnt
atggaacgttgcggctgggtgagtcaggacccgctttatattgcctaccatgataatgag
tggggcgtgcctgaaactgacagtaaaaaactgttcgaaatgatctgccttgaagggcag
caggctggattatcgtggatcaccgtcctcaaaaaacgcgaaaactatcgcgcctgcttt
catcagttcgatccggtgaaggtcgcagcaatgcaggaagaggatgtcgaaagactggta
caggacgccgggattatccgccatcgagggaaaattcaggcaattattggtaatgcgcgg
gcgtacctgcaaatggaacagaacggcgaaccgtttgtcgactttgtctggtcgtttgta
aatcatcagccacaggtgacacaagccacaacgttgagcgaaattcccacatctacgtcc
gcctccgacgccctatctaaggcactgaaaaaacgtggttttaagtttgtcggcaccaca
atctgttactcctttatgcaggcatgtgggctggtgaatgatcatgtggttggctgctgt
tgctatccgggaaataaaccatga

DBGET integrated database retrieval system