ecj:JW3610; : No such data.

KEGG   Escherichia coli K-12 MG1655: b3635
Entry
b3635             CDS       T00007                                 

Gene name
mutM
Definition
(RefSeq) DNA-formamidopyrimidine glycosylase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:eco00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    b3635 (mutM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:eco03400]
    b3635 (mutM)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     b3635 (mutM)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     b3635 (mutM)
DNA repair and recombination proteins [BR:eco03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     b3635 (mutM)
SSDB
Motif
Pfam: H2TH Fapy_DNA_glyco zf-FPG_IleRS Auto_anti-p27 zf-dskA_traR
Other DBs
NCBI-GeneID: 946765
NCBI-ProteinID: NP_418092
Pasteur: mutM
RegulonDB: ECK120000323
ECOCYC: EG10329
ASAP: ABE-0011877
UniProt: P05523
Structure
PDB: 
1K82

Position
complement(3810343..3811152)
AA seq 269 aa
MPELPEVETSRRGIEPHLVGATILHAVVRNGRLRWPVSEEIYRLSDQPVLSVQRRAKYLL
LELPEGWIIIHLGMSGSLRILPEELPPEKHDHVDLVMSNGKVLRYTDPRRFGAWLWTKEL
EGHNVLTHLGPEPLSDDFNGEYLHQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAG
IHPDRLASSLSLAECELLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRK
GEPCRVCGTPIVATKHAQRATFYCRQCQK
NT seq 810 nt   +upstreamnt  +downstreamnt
atgcctgaattacccgaagttgaaaccagccgccgcggcatagaaccgcatctcgttggt
gcaaccattcttcatgcagtggtgcgcaacggacgcttgcgctggccggtttcagaagag
atctaccgtttaagcgaccaaccagtgcttagcgtgcagcggcgggctaaatatctgctg
ctggagctgcctgagggctggattatcattcatttagggatgtctggcagcctgcgcatc
cttccagaagaacttccccctgaaaagcatgaccatgtggatttggtgatgagcaacggc
aaagtgctgcgctacaccgatccgcgccgctttggtgcctggctgtggaccaaagagctg
gaagggcataatgtgctgacccatcttggaccggagccgcttagcgacgatttcaatggt
gagtatctgcatcagaagtgcgcgaagaaaaaaacggcgattaaaccgtggctgatggat
aacaagctggtggtaggggtagggaatatctatgccagcgaatcactgtttgcggcgggg
atccatccggatcggctggcgtcatcactgtcgctggcagagtgtgaattgttagctcgg
gtgattaaagcggtgttgctgcgttcgattgagcagggtggtacaacgctgaaagatttt
ctgcaaagtgatggtaaaccgggctatttcgctcaggaattgcaggtttacgggcgaaaa
ggtgagccgtgtcgggtgtgcggtacgccgattgtggcgactaaacatgcgcagcgggca
acgttttattgtcggcagtgccagaagtaa

DBGET integrated database retrieval system