KEGG   Escherichia coli K-12 W3110: JW3633
Entry
JW3633            CDS       T00068                                 

Symbol
setC
Name
(GenBank) predicted sugar efflux system
  KO
K03291  MFS transporter, SET family, sugar efflux transporter
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW3633 (setC)
Transporters [BR:ecj02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar efflux transporter (SET) [TC:2.A.1.20]
    JW3633 (setC)
SSDB
Motif
Pfam: MFS_1 MFS_1_like
Other DBs
NCBI-ProteinID: BAE77635
UniProt: P31436
Position
complement(3802278..3803462)
AA seq 394 aa
MQKTATTPSKILDLTAAAFLLVAFLTGIAGALQTPTLSIFLADELKARPIMVGFFFTGSA
IMGILVSQFLARHSDKQGDRKLLILLCCLFGVLACTLFAWNRNYFILLSTGVLLSSFAST
ANPQMFALAREHADRTGRETVMFSTFLRAQISLAWVIGPPLAYELAMGFSFKVMYLTAAI
AFVVCGLIVWLFLPSIQRNIPVVTQPVEILPSTHRKRDTRLLFVVCSMMWAANNLYMINM
PLFIIDELHLTDKLTGEMIGIAAGLEIPMMLIAGYYMKRIGKRLLMLIAIVSGMCFYASV
LMATTPAVELELQILNAIFLGILCGIGMLYFQDLMPEKIGSATTLYANTSRVGWIIAGSV
DGIMVEIWSYHALFWLAIGMLGIAMICLLFIKDI
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgcaaaaaacggctaccactccatcaaaaatacttgatctcactgccgcggcattttta
cttgtcgcctttctgacgggtattgcgggcgctcttcagactcctaccctaagtatattc
ctcgcagatgaactgaaagcccgtcctataatggtaggttttttcttcaccggtagcgct
attatgggaattctggtcagtcaatttctggcaaggcactccgataaacaaggcgaccgt
aaattactgattctgctatgttgcttatttggagtgctggcctgcacgctttttgcgtgg
aatcgcaactacttcattctcctctcaacgggcgtacttctgagtagttttgcttccacc
gcaaacccgcaaatgttcgccctcgcccgtgaacacgccgacagaacaggccgtgagacg
gtcatgttcagtacatttttacgtgctcagatctcgcttgcctgggttatcgggccaccg
ctcgcttatgaactggcaatgggatttagttttaaagtgatgtatctcaccgctgccatc
gcatttgttgtttgcggactgatagtctggttgtttttgccatcaatacaaagaaatatt
cctgtcgttacccaacccgtagaaattttaccctccacccacaggaagcgggatacgcgg
ctactttttgtggtctgttcaatgatgtgggcggcgaataatctctacatgataaatatg
ccgctatttattattgatgaactgcatctaaccgataaactgactggagaaatgattggt
atcgctgccggtctggaaattccgatgatgttaatcgcaggctattacatgaaacgtatt
ggcaagcgactattaatgctcattgctatcgtgagtggaatgtgtttttacgccagcgta
ctcatggcgacgactccggcggttgagctggaattgcaaattcttaatgccatcttcctt
ggtattctctgtggtatcggcatgctttattttcaggacttgatgcctgaaaaaataggc
tctgcgacaacgttatatgcaaatacttcacgcgtcggctggattatcgccggctctgtt
gacggaattatggttgaaatctggagctaccatgcgttgttctggctggcgatagggatg
ttgggtattgcgatgatttgcctgctgtttattaaagatatttag

DBGET integrated database retrieval system