KEGG   Escherichia coli K-12 W3110: JW3634Help
Entry
JW3634            CDS       T00068                                 

Gene name
yicL
Definition
(GenBank) predicted inner membrane protein
Organism
ecj  Escherichia coli K-12 W3110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA QCR10
Motif
Other DBs
NCBI-ProteinID: BAE77634
UniProt: P31437
Position
complement(3801244..3802167)
Genome map
AA seq 307 aa AA seqDB search
MGSTRKGMLNVLIAAVLWGSSGVCAQYIMEQSQMSSQFLTMTRLIFAGLILLTLSFVHGD
KIFSIINNHKDAISLLIFSVVGALTVQLTFLLTIEKSNAATATVLQFLSPTIIVAWFSLV
RKSRPGILVFCAILTSLVGTFLLVTHGNPTSLSISPAALFWGIASAFAAAFYTTYPSTLI
ARYGTLPVVGWSMLIGGLILLPFYARQGTNFVVNGSLILAFFYLVVIGTSLTFSLYLKGA
QLIGGPKASILSCAEPLSSALLSLLLLGITFTLPDWLGTLLILSSVILISMDSRRRARKI
NRPARHK
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgggttccaccagaaaggggatgctgaacgttctgattgccgccgtgttgtggggaagt
tcaggggtctgcgcgcaatacatcatggagcaaagccagatgtcgtcgcagtttttgact
atgacgcgtttgatattcgccggtttgattctactgacgctgtcatttgttcatggcgat
aaaatcttttctattattaacaatcataaagatgccattagcctgctgattttttccgtg
gttggcgcgctaactgtacagctcacttttttgctaaccatcgaaaaatcgaacgcagcc
acggcaacggtgctgcaattcctctcaccgacgattatcgtcgcctggttctcactggtg
cgtaaatcgcgcccgggcattctggttttctgcgctattttgacatcgctggtcgggact
tttttattggtgacacacggtaatccgacgtcattatcgatctctcctgccgcgttgttc
tggggcattgcctcggcatttgctgctgcattctataccacctatccctcaacgctaatt
gcccgctatggcacgttaccagtcgtcggctggagtatgctgattggcggtctgattctg
ttgcctttttatgccagacaaggaacaaactttgtcgttaacggcagtttgattctggcg
tttttttatttggtggtcattggtacgtccctgacatttagtctgtacctgaaaggagca
caattaattggcggtccaaaagccagcattttgagctgtgcagaaccattaagtagcgcg
ctactctctttgctgttgctggggatcacgttcacattaccggactggctgggaacgctg
ctgattctgtcatcggtgattttgatttcaatggattcccgtcgccgcgccagaaaaata
aatcgtccggcgcggcataagtga

DBGET integrated database retrieval system