KEGG   Escherichia coli K-12 W3110: JW3645Help
Entry
JW3645            CDS       T00068                                 

Gene name
ilvN
Definition
(GenBank) acetolactate synthase I, small subunit
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00290  Valine, leucine and isoleucine biosynthesis
ecj00650  Butanoate metabolism
ecj00660  C5-Branched dibasic acid metabolism
ecj00770  Pantothenate and CoA biosynthesis
ecj01100  Metabolic pathways
ecj01110  Biosynthesis of secondary metabolites
ecj01130  Biosynthesis of antibiotics
ecj01210  2-Oxocarboxylic acid metabolism
ecj01230  Biosynthesis of amino acids
Module
ecj_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
ecj_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    JW3645 (ilvN)
   00660 C5-Branched dibasic acid metabolism
    JW3645 (ilvN)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    JW3645 (ilvN)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    JW3645 (ilvN)
Enzymes [BR:ecj01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     JW3645 (ilvN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACT ACT_5 ACT_4
Motif
Other DBs
NCBI-ProteinID: BAE77623
UniProt: P0ADF8
Structure
PDB: 

Position
3789323..3789613
Genome map
AA seq 96 aa AA seqDB search
MQNTTHDNVILELTVRNHPGVMTHVCGLFARRAFNVEGILCLPIQDSDKSHIWLLVNDDQ
RLEQMISQIDKLEDVVKVQRNQSDPTMFNKIAVFFQ
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacacaactcatgacaacgtaattctggagctcaccgttcgcaaccatccgggc
gtaatgacccacgtttgtggcctttttgcccgccgcgcttttaacgttgaaggcattctt
tgtctgccgattcaggacagcgacaaaagccatatctggctactggtcaatgacgaccag
cgtctggagcagatgataagccaaatcgataagctggaagatgtcgtgaaagtgcagcgt
aatcagtccgatccgacgatgtttaacaagatcgcggtgttttttcagtaa

DBGET integrated database retrieval system