KEGG   Escherichia coli K-12 W3110: JW3679Help
Entry
JW3679            CDS       T00068                                 

Gene name
dnaA
Definition
(GenBank) chromosomal replication initiator protein DnaA, DNA-binding transcriptional dual regulator
  KO
K02313  chromosomal replication initiator protein
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    JW3679 (dnaA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ecj03032]
    JW3679 (dnaA)
   03036 Chromosome and associated proteins [BR:ecj03036]
    JW3679 (dnaA)
DNA replication proteins [BR:ecj03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    JW3679 (dnaA)
Chromosome and associated proteins [BR:ecj03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    JW3679 (dnaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA Bac_DnaA_C DnaA_N IstB_IS21 AAA Kinesin AAA_14 AAA_16 NACHT AFG1_ATPase ATPase_2 BLOC1S3 RNA_helicase AAA_19
Motif
Other DBs
NCBI-ProteinID: BAE77592
UniProt: P03004
Structure
PDB: 

Position
3756686..3758089
Genome map
AA seq 467 aa AA seqDB search
MSLSLWQQCLARLQDELPATEFSMWIRPLQAELSDNTLALYAPNRFVLDWVRDKYLNNIN
GLLTSFCGADAPQLRFEVGTKPVTQTPQAAVTSNVAAPAQVAQTQPQRAAPSTRSGWDNV
PAPAEPTYRSNVNVKHTFDNFVEGKSNQLARAAARQVADNPGGAYNPLFLYGGTGLGKTH
LLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALLIDDIQFF
ANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELE
TRVAILMKKADENDIRLPGEVAFFIAKRLRSNVRELEGALNRVIANANFTGRAITIDFVR
EALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNH
SLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTLSS
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
gtgtcactttcgctttggcagcagtgtcttgcccgattgcaggatgagttaccagccaca
gaattcagtatgtggatacgcccattgcaggcggaactgagcgataacacgctggccctg
tacgcgccaaaccgttttgtcctcgattgggtacgggacaagtaccttaataatatcaat
ggactgctaaccagtttctgcggagcggatgccccacagctgcgttttgaagtcggcacc
aaaccggtgacgcaaacgccacaagcggcagtgacgagcaacgtcgcggcccctgcacag
gtggcgcaaacgcagccgcaacgtgctgcgccttctacgcgctcaggttgggataacgtc
ccggccccggcagaaccgacctatcgttctaacgtaaacgtcaaacacacgtttgataac
ttcgttgaaggtaaatctaaccaactggcgcgcgcggcggctcgccaggtggcggataac
cctggcggtgcctataacccgttgttcctttatggcggcacgggtctgggtaaaactcac
ctgctgcatgcggtgggtaacggcattatggcgcgcaagccgaatgccaaagtggtttat
atgcactccgagcgctttgttcaggacatggttaaagccctgcaaaacaacgcgatcgaa
gagtttaaacgctactaccgttccgtagatgcactgctgatcgacgatattcagtttttt
gctaataaagaacgatctcaggaagagtttttccacaccttcaacgccctgctggaaggt
aatcaacagatcattctcacctcggatcgctatccgaaagagatcaacggcgttgaggat
cgtttgaaatcccgcttcggttggggactgactgtggcgatcgaaccgccagagctggaa
acccgtgtggcgatcctgatgaaaaaggccgacgaaaacgacattcgtttgccgggcgaa
gtggcgttctttatcgccaagcgtctacgatctaacgtacgtgagctggaaggggcgctg
aaccgcgtcattgccaatgccaactttaccggacgggcgatcaccatcgacttcgtgcgt
gaggcgctgcgcgacttgctggcattgcaggaaaaactggtcaccatcgacaatattcag
aagacggtggcggagtactacaagatcaaagtcgcggatctcctttccaagcgtcgatcc
cgctcggtggcgcgtccgcgccagatggcgatggcgctggcgaaagagctgactaaccac
agtctgccggagattggcgatgcgtttggtggccgtgaccacacgacggtgcttcatgcc
tgccgtaagatcgagcagttgcgtgaagagagccacgatatcaaagaagatttttcaaat
ttaatcagaacattgtcatcgtaa

DBGET integrated database retrieval system