KEGG   Escherichia coli K-12 W3110: JW3714Help
Entry
JW3714            CDS       T00068                                 

Gene name
atpF
Definition
(GenBank) F0 sector of membrane-bound ATP synthase, subunit b
  KO
K02109  F-type H+-transporting ATPase subunit b
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00190  Oxidative phosphorylation
ecj01100  Metabolic pathways
Module
ecj_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    JW3714 (atpF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:ecj00194]
    JW3714 (atpF)
Photosynthesis proteins [BR:ecj00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   JW3714 (atpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_B Mt_ATP-synt_B FNIP_C V-ATPase_G_2 ESM4 V-ATPase_G ETRAMP
Motif
Other DBs
NCBI-ProteinID: BAE77552
UniProt: P0ABA0
Structure
PDB: 

Position
3715793..3716263
Genome map
AA seq 156 aa AA seqDB search
MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS
ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREEL
RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcttaacgcaacaatcctcggccaggccatcgcgtttgtcctgttcgttctgttc
tgcatgaagtacgtatggccgccattaatggcagccatcgaaaaacgtcaaaaagaaatt
gctgacggccttgcttccgcagaacgagcacataaggaccttgaccttgcaaaggccagc
gcgaccgaccagctgaaaaaagcgaaagcggaagcccaggtaatcatcgagcaggcgaac
aaacgccgctcgcagattctggacgaagcgaaagctgaggcagaacaggaacgtactaaa
atcgtggcccaggcgcaggcggaaattgaagccgagcgtaaacgtgcccgtgaagagctg
cgtaagcaagttgctatcctggctgttgctggcgccgagaagatcatcgaacgttccgtg
gatgaagctgctaacagcgacatcgtggataaacttgtcgctgaactgtaa

DBGET integrated database retrieval system