KEGG   Escherichia coli K-12 W3110: JW3747
Entry
JW3747            CDS       T00068                                 

Gene name
ilvC
Definition
(GenBank) ketol-acid reductoisomerase, NAD(P)-binding
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00290  Valine, leucine and isoleucine biosynthesis
ecj00770  Pantothenate and CoA biosynthesis
ecj01100  Metabolic pathways
ecj01110  Biosynthesis of secondary metabolites
ecj01210  2-Oxocarboxylic acid metabolism
ecj01230  Biosynthesis of amino acids
Module
ecj_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
ecj_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    JW3747 (ilvC)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    JW3747 (ilvC)
Enzymes [BR:ecj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     JW3747 (ilvC)
SSDB
Motif
Pfam: IlvN IlvC 2-Hacid_dh_C NAD_binding_7 ApbA AdoHcyase_NAD
Other DBs
NCBI-ProteinID: BAE77523
UniProt: P05793
Structure
PDB: 
3ULK 1YRL

Position
complement(3677236..3678711)
AA seq 491 aa
MANYFNTLNLRQQLAQLGKCRFMGRDEFADGASYLQGKKVVIVGCGAQGLNQGLNMRDSG
LDISYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVINLTPDKQHSDVVRTVQP
LMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAVHPE
NDPKGEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAGSLLCFDKL
VEEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQLKEIMAPLF
QKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFETAPQYEGKIGEQEYFDKGVL
MIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNVVISDTAEYG
NYLFSYACVPLLKPFMAELQPGDLGKAIPEGAVDNGQLRDVNEAIRSHAIEQVGKKLRGY
MTDMKRIAVAG
NT seq 1476 nt   +upstreamnt  +downstreamnt
atggctaactacttcaatacactgaatctgcgccagcagctggcacagctgggcaaatgt
cgctttatgggccgcgatgaattcgccgatggcgcgagctaccttcagggtaaaaaagta
gtcatcgtcggctgtggcgcacagggtctgaaccagggcctgaacatgcgtgattctggt
ctcgatatctcctacgctctgcgtaaagaagcgattgccgagaagcgcgcgtcctggcgt
aaagcgaccgaaaatggttttaaagtgggtacttacgaagaactgatcccacaggcggat
ctggtgattaacctgacgccggacaagcagcactctgatgtagtgcgcaccgtacagcca
ctgatgaaagacggcgcggcgctgggctactcgcacggtttcaacatcgtcgaagtgggc
gagcagatccgtaaagatatcaccgtagtgatggttgcgccgaaatgcccaggcaccgaa
gtgcgtgaagagtacaaacgtgggttcggcgtaccgacgctgattgccgttcacccggaa
aacgatccgaaaggcgaaggcatggcgattgccaaagcctgggcggctgcaaccggtggt
caccgtgcgggtgtgctggaatcgtccttcgttgcggaagtgaaatctgacctgatgggc
gagcaaaccatcctgtgcggtatgttgcaggctggctctctgctgtgcttcgacaagctg
gtggaagaaggtaccgatccagcatacgcagaaaaactgattcagttcggttgggaaacc
atcaccgaagcactgaaacagggcggcatcaccctgatgatggaccgtctctctaacccg
gcgaaactgcgtgcttatgcgctttctgaacagctgaaagagatcatggcacccctgttc
cagaaacatatggacgacatcatctccggcgaattctcttccggtatgatggcggactgg
gccaacgatgataagaaactgctgacctggcgtgaagagaccggcaaaaccgcgtttgaa
accgcgccgcagtatgaaggcaaaatcggcgagcaggagtacttcgataaaggcgtactg
atgattgcgatggtgaaagcgggcgttgaactggcgttcgaaaccatggtcgattccggc
atcattgaagagtctgcatattatgaatcactgcacgagctgccgctgattgccaacacc
atcgcccgtaagcgtctgtacgaaatgaacgtggttatctctgataccgctgagtacggt
aactatctgttctcttacgcttgtgtgccgttgctgaaaccgtttatggcagagctgcaa
ccgggcgacctgggtaaagctattccggaaggcgcggtagataacgggcaactgcgtgat
gtgaacgaagcgattcgcagccatgcgattgagcaggtaggtaagaaactgcgcggctat
atgacagatatgaaacgtattgctgttgcgggttaa

DBGET integrated database retrieval system