KEGG   Escherichia coli K-12 W3110: JW3778Help
Entry
JW3778            CDS       T00068                                 

Gene name
cyaA
Definition
(GenBank) adenylate cyclase
  KO
K05851  adenylate cyclase, class 1 [EC:4.6.1.1]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00230  Purine metabolism
ecj02026  Biofilm formation - Escherichia coli
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    JW3778 (cyaA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02026 Biofilm formation - Escherichia coli
    JW3778 (cyaA)
Enzymes [BR:ecj01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     JW3778 (cyaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylate_cycl Adenyl_cycl_N
Motif
Other DBs
NCBI-ProteinID: BAE77495
UniProt: P00936
Position
complement(3642982..3645528)
Genome map
AA seq 848 aa AA seqDB search
MYLYIETLKQRLDAINQLRVDRALAAMGPAFQQVYSLLPTLLHYHHPLMPGYLDGNVPKG
ICLYTPDETQRHYLNELELYRGMSVQDPPKGELPITGVYTMGSTSSVGQSCSSDLDIWVC
HQSWLDSEERQLLQRKCSLLENWAASLGVEVSFFLIDENRFRHNESGSLGGEDCGSTQHI
LLLDEFYRTAVRLAGKRILWNMVPCDEEEHYDDYVMTLYAQGVLTPNEWLDLGGLSSLSA
EEYFGASLWQLYKSIDSPYKAVLKTLLLEAYSWEYPNPRLLAKDIKQRLHDGEIVSFGLD
PYCMMLERVTEYLTAIEDFTRLDLVRRCFYLKVCEKLSRERACVGWRRAVLSQLVSEWGW
DEARLAMLDNRANWKIDQVREAHNELLDAMMQSYRNLIRFARRNNLSVSASPQDIGVLTR
KLYAAFEALPGKVTLVNPQISPDLSEPNLTFIYVPPGRANRSGWYLYNRAPNIESIISHQ
PLEYNRYLNKLVAWAWFNGLLTSRTRLYIKGNGIVDLPKLQEMVADVSHHFPLRLPAPTP
KALYSPCEIRHLAIIVNLEYDPTAAFRNQVVHFDFRKLDVFSFGENQNCLVGSVDLLYRN
SWNEVRTLHFNGEQSMIEALKTILGKMHQDAAPPDSVEVFCYSQHLRGLIRTRVQQLVSE
CIELRLSSTRQETGRFKALRVSGQTWGLFFERLNVSVQKLENAIEFYGAISHNKLHGLSV
QVETNHVKLPAVVDGFASEGIIQFFFEETQDENGFNIYILDESNRVEVYHHCEGSKEELV
RDVSRFYSSSHDRFTYGSSFINFNLPQFYQIVKVDGREQVIPFRTKSIGNMPPANQDHDT
PLLQQYFS
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
ttgtacctctatattgagactctgaaacagagactggatgccataaatcaattgcgtgtg
gatcgcgcgcttgctgctatggggcctgcattccaacaggtctacagtctactgccgaca
ttgttgcactatcaccatccgctaatgccgggttaccttgatggtaacgttcccaaaggc
atttgcctttacacgcctgatgaaactcaacgccactacctgaacgagcttgaactgtat
cgtggaatgtcagtacaggatccgccgaaaggtgagcttccaattactggtgtatacacc
atgggcagcacctcgtccgtagggcaaagttgttcctctgacctggatatctgggtctgt
catcaatcctggctcgatagcgaagagcgccaattgctacaacgtaaatgtagcctgctg
gaaaactgggccgcctcgctgggtgtggaagtcagcttcttcctgattgatgaaaaccgc
ttccgtcataatgaaagcggcagcctggggggcgaagattgtggctccacccagcatata
ctgctgcttgacgaattttatcgtaccgccgtgcgtctcgccggtaagcgtattctgtgg
aatatggtgccgtgcgacgaagaagagcattacgacgactatgtgatgacgctttacgcg
cagggcgtgctgacgccaaatgaatggctggatctcggtggcttaagctcgctttctgct
gaagagtactttggtgccagcctttggcagctctacaagagtatcgattccccatacaaa
gcggtactgaaaacactgctgctggaagcctattcctgggaatacccgaacccacgtctg
ctggcgaaagatatcaaacagcgtttgcacgacggcgagattgtatcgtttggtctcgat
ccatactgcatgatgctggagcgtgttactgaatacctgacggcgattgaagattttacc
cgtctggatttagtacgtcgctgcttctatttaaaagtgtgcgaaaagctcagccgtgaa
cgcgcctgcgtaggctggcgtcgcgcagtgttgagccagttagtgagcgagtggggttgg
gacgaagctcgtctggcaatgctcgataaccgcgctaactggaagattgatcaggtgcgt
gaggcgcacaacgagttgctcgacgcgatgatgcagagctaccgtaatctgatccgcttt
gcgcgtcgcaataaccttagcgtctccgccagtccgcaggatatcggcgtgctgacgcgt
aagctgtatgccgcgtttgaagcattaccaggtaaagtgacgctggtaaacccgcagatt
tcacccgatctctcggaaccgaatctgacctttatttatgtgccgccgggccgggctaac
cgttcaggttggtatctgtataaccgcgcgccaaatattgagtcgatcatcagccatcag
ccgctggaatataaccgttacctgaataaactggtggcgtgggcatggtttaacggcctg
ctgacctcgcgcacccgtttgtatattaaaggtaacggcattgtcgatttgcctaagttg
caggagatggtcgccgacgtgtcgcaccatttcccgctgcgcttacctgcaccgacaccg
aaggcgctctacagcccgtgtgagatccgccatctggcgattatcgttaacctggaatat
gacccgacagcggcgttccgcaatcaggtggtgcatttcgatttccgtaagctggatgtc
ttcagctttggcgagaatcaaaattgcctggtaggtagcgttgacctgctgtaccgcaac
tcgtggaacgaagtgcgtacgctgcacttcaacggcgagcaatcgatgatcgaagccctg
aaaactattctcggcaaaatgcatcaggacgccgcaccgccagatagcgtggaagtcttc
tgttatagccagcatctgcgcggcttaattcgtactcgcgtgcagcaactggtttctgag
tgtattgaattgcgtctttccagcacccgccaggaaaccgggcgtttcaaggcgctgcgc
gtttctggtcaaacctgggggttgttcttcgaacgcctgaatgtatcggtacagaaactg
gaaaacgccatcgagttttatggcgcgatttcgcataacaaactgcacggcctgtcagtg
caggttgaaaccaatcacgtcaaattaccggcggtggtggacggctttgccagcgaaggg
atcatccagttctttttcgaagaaacgcaagacgagaatggctttaatatctacattctc
gacgaaagcaaccgggttgaggtatatcaccactgcgaaggcagcaaagaggagctggta
cgtgacgtcagtcgcttctactcgtcatcgcatgaccgttttacctacggctcaagcttc
atcaacttcaacctgccgcagttctatcagattgtgaaggttgatggtcgtgaacaggtg
attccgttccgcacaaaatctatcggtaacatgccgcctgccaatcaggatcacgatacg
ccgctattacagcaatatttttcgtga

DBGET integrated database retrieval system