KEGG   Escherichia coli K-12 W3110: JW3783
Entry
JW3783            CDS       T00068                                 

Gene name
yigA
Definition
(GenBank) conserved hypothetical protein
  KO
K09921  uncharacterized protein
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    JW3783 (yigA)
SSDB
Motif
Pfam: DUF484 ScsC_N
Other DBs
NCBI-ProteinID: BAE77490
UniProt: P23305
Position
complement(3640391..3641098)
AA seq 235 aa
MKQPGEELQETLTELDDRAVVDYLIKNPEFFIRNARAVEAIRVPHPVRGTVSLVEWHMAR
ARNHIHVLEENMALLMEQAIANEGLFYRLLYLQRSLTAASSLDDMLMRFHRWARDLGLAG
ASLRLFPDRWRLGAPSNHTHLALSRQSFEPLRIQRLGQEQHYLGPLNGPELLVVLPEAKA
VGSVAMSMLGSDADLGVVLFTSRDASHYQQGQGTQLLHEIALMLPELLERWIERV
NT seq 708 nt   +upstreamnt  +downstreamnt
atgaagcaaccaggggaagaactgcaggaaacactcacggagcttgatgaccgggcggtt
gtcgattatctgattaaaaatcctgagttttttatccgtaatgcgcgcgcagtagaagcg
atacgtgtgccgcatccggtacgcggcaccgtttcgttggtcgagtggcacatggcccgc
gcacgtaatcatattcatgttctggaagagaacatggcgctgttgatggaacaggctatc
gccaacgaaggcctgttttatcgcctactctacctgcagcgcagtctcaccgccgccagc
agtctcgacgatatgctgatgcgctttcaccgctgggcgcgcgatctcggcctggcaggt
gcgagtctgcgcctgtttccggatcgctggcgcttaggtgcgccgtcgaaccacactcat
ctggcattaagccgtcagtctttcgaaccgctgcgtattcagcgtttggggcaggaacag
cactatcttgggccgcttaacggaccagagctgctggtggtgctaccggaagcgaaagcg
gtgggatcggtggcgatgtcgatgctgggaagcgatgctgatttgggtgtcgtgctgttt
accagtcgcgatgccagtcactatcaacaagggcaaggaacgcagttacttcatgaaatt
gcgctgatgttgccggagcttctggagcgttggattgaacgcgtatga

DBGET integrated database retrieval system