KEGG   Escherichia coli K-12 W3110: JW3811
Entry
JW3811            CDS       T00068                                 

Gene name
yigP
Definition
(GenBank) conserved hypothetical protein
  KO
K03690  ubiquinone biosynthesis protein UbiJ
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99987 Cofactor metabolism
    JW3811 (yigP)
SSDB
Motif
Pfam: SCP2 Alkyl_sulf_C
Other DBs
NCBI-ProteinID: BAE77467
UniProt: P0ADP7
Structure
PDB: 
6H6O 6H6N 6H6P

Position
complement(3616452..3617057)
AA seq 201 aa
MPFKPLVTAGIESLLNTFLYRSPALKTARSRLLGKVLRVEVKGFSTSLILVFSERQVDVL
GEWAGDADCTVIAYASVLPKLRDRQQLTALIRSGELEVQGDIQVVQNFVALADLAEFDPA
ELLAPYTGDIAAEGISKAMRGGAKFLHHGIKRQQRYVAEAITEEWRMAPGPLEVAWFAEE
TAAVERAVDALTKRLEKLEAK
NT seq 606 nt   +upstreamnt  +downstreamnt
atgccttttaaacctttagtgacggcaggaattgaaagtctgctcaacaccttcctgtat
cgctcacccgcgctgaaaacggcccgctcgcgtctgctgggtaaagtattgcgcgtggag
gtaaaaggcttttcgacgtcattgattctggtgttcagcgaacgccaggttgatgtactg
ggcgaatgggcaggcgatgctgactgcaccgttatcgcctacgccagtgtgttgccgaaa
cttcgcgatcgccagcagcttaccgcactgattcgcagtggtgagctggaagtgcagggc
gatattcaggtggtgcaaaacttcgttgcgctggcagatctggcagagttcgaccctgcg
gaactgctggccccttataccggtgatatcgccgctgaaggaatcagcaaagccatgcgc
ggaggcgcaaagttcctgcatcacggcattaagcgccagcaacgttatgtggcggaagcc
attactgaagagtggcgtatggcacccggtccgcttgaagtggcctggtttgcggaagag
acggctgccgtcgagcgtgctgttgatgccctgaccaaacggctggaaaaactggaggct
aaatga

DBGET integrated database retrieval system