KEGG   Escherichia coli K-12 W3110: JW3813Help
Entry
JW3813            CDS       T00068                                 

Gene name
tatA
Definition
(GenBank) TatABCE protein translocation system subunit
  KO
K03116  sec-independent protein translocase protein TatA
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj03060  Protein export
ecj03070  Bacterial secretion system
Module
ecj_M00336  Twin-arginine translocation (Tat) system
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    JW3813 (tatA)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    JW3813 (tatA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecj02044]
    JW3813 (tatA)
Secretion system [BR:ecj02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein [MD:M00336]
   JW3813 (tatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MttA_Hcf106 DUF1980 DUF4834
Motif
Other DBs
NCBI-ProteinID: BAE77465
UniProt: P69428
Structure
PDB: 

Position
complement(3614467..3614736)
Genome map
AA seq 89 aa AA seqDB search
MGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFT
AKTIADKQADTNQEQAKTEDAKRHDKEQV
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgggtggtatcagtatttggcagttattgattattgccgtcatcgttgtactgcttttt
ggcaccaaaaagctcggctccatcggttccgatcttggtgcgtcgatcaaaggctttaaa
aaagcaatgagcgatgatgaaccaaagcaggataaaaccagtcaggatgctgattttact
gcgaaaactatcgccgataagcaggcggatacgaatcaggaacaggctaaaacagaagac
gcgaagcgccacgataaagagcaggtgtaa

DBGET integrated database retrieval system