KEGG   Escherichia coli K-12 W3110: JW3827Help
Entry
JW3827            CDS       T00068                                 

Gene name
hemG
Definition
(GenBank) protoporphyrin oxidase, flavoprotein
  KO
K00230  menaquinone-dependent protoporphyrinogen oxidase [EC:1.3.5.3]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00860  Porphyrin and chlorophyll metabolism
ecj01100  Metabolic pathways
ecj01110  Biosynthesis of secondary metabolites
Module
ecj_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    JW3827 (hemG)
Enzymes [BR:ecj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.3  protoporphyrinogen IX dehydrogenase (menaquinone)
     JW3827 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavodoxin_5 Flavodoxin_1 Flavodoxin_3 SBP_bac_5 DUF2194 PTS_IIB FMN_red
Motif
Other DBs
NCBI-ProteinID: BAE77453
UniProt: P0ACB4
Position
complement(3601528..3602073)
Genome map
AA seq 181 aa AA seqDB search
MKTLILFSTRDGQTREIASYLASELKELGIQADVANVHRIEEPQWENYDRVVIGASIRYG
HYHSAFQEFVKKHATRLNSMPSAFYSVNLVARKPEKRTPQTNSYARKFLMNSQWRPDRCA
VIAGALRYPRYRWYDRFMIKLIMKMSGGETDTRKEVVYTDWEQVANFAREIAHLTDKPTL
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaacattaattcttttctcaacaagggacggacaaacgcgcgagattgcctcctac
ctggcttcggaactgaaagaactggggatccaggcggatgtcgccaatgtgcaccgcatt
gaagaaccacagtgggaaaactatgaccgtgtggtcattggtgcttctattcgctatggt
cactaccattcagcgttccaggaatttgtcaaaaaacatgcgacgcggctgaattcgatg
ccgagcgccttttactccgtgaatctggtggcgcgcaaaccggagaagcgtactccacag
accaacagctacgcgcgcaagtttctgatgaactcgcaatggcgtcccgatcgctgcgcg
gtcattgccggggcgctgcgttacccacgttatcgctggtacgaccgttttatgatcaag
ctgattatgaagatgtcaggcggtgaaacggatacgcgcaaagaagttgtctataccgat
tgggagcaggtggcgaatttcgcccgagaaatcgcccatttaaccgacaaaccgacgctg
aaataa

DBGET integrated database retrieval system