KEGG   Escherichia coli K-12 W3110: JW3845Help
Entry
JW3845            CDS       T00068                                 

Gene name
yihN
Definition
(GenBank) predicted transporter
Organism
ecj  Escherichia coli K-12 W3110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-ProteinID: BAE77435
UniProt: P32135
Position
complement(3573169..3574434)
Genome map
AA seq 421 aa AA seqDB search
MLTKKKWALFSLLTLCGGTIYKLPSLKDAFYIPMQEYFHLTNGQIGNAMSVNSFVTTVGF
FLSIYFADKLPRRYTMSFSLIATGLLGVYLTTMPGYWGILFVWALFGVTCDMMNWPVLLK
SVSRLGNSEQQGRLFGFFETGRGIVDTVVAFSALAVFTWFGSGLLGFKAGIWFYSLIVIA
VGIIIFFVLNDKEEAPSVEVKKEDGASKNTSMTSVLKDKTIWLIAFNVFFVYAVYCGLTF
FIPFLKNIYLLPVALVGAYGIINQYCLKMIGGPIGGMISDKILKSPSKYLCYTFIISTAA
LVLLIMLPHESMPVYLGMACTLGFGAIVFTQRAVFFAPIGEAKIAENKTGAAMALGSFIG
YAPAMFCFSLYGYILDLNPGIIGYKIVFGIMACFAFSGAVVSVMLVKRISQRKKEMLAAE
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgctcacgaaaaagaaatgggcgttatttagtctattaacactgtgtggcggtacaatt
tataaattaccgtcgctgaaagatgcgttttatatcccgatgcaggaatatttccatttg
accaatggtcaaattggtaatgctatgtcggtaaactcatttgtcaccacagtgggcttt
tttctgtctatttattttgccgataaactaccgcgcagatacaccatgtcattctcactc
attgcgacaggattactgggtgtttatttgacgacaatgccggggtattggggcatcctc
tttgtctgggcgctatttggcgttacttgcgacatgatgaactggccggtcttgctcaag
tcggtaagtcgattgggcaatagcgaacaacaaggtcggttgtttggcttcttcgaaaca
gggcgtggcattgtcgataccgtggtggcattttctgcgttggcagtatttacctggttt
ggcagtggcttattaggttttaaagcaggcatctggttctattcccttattgtgattgcc
gtaggcattattattttctttgtcctgaatgacaaagaagaggcaccgtccgttgaggtg
aaaaaagaagacggagcatcgaaaaacaccagtatgacctcggtgctgaaagacaaaact
atctggcttatcgcttttaacgtcttcttcgtttacgcggtttactgtggcctgacattc
ttcattccattcctgaaaaacatctatctattgcccgttgcgctggtgggggcttacggc
atcattaaccaatactgtctgaaaatgattggtggaccgattggtggcatgatttcagat
aagatcctgaaatcgccaagtaaatatctatgctacacctttatcattagtaccgctgcg
ctcgtactgttgattatgctgccgcacgaaagtatgccggtctatttagggatggcatgt
acgctgggctttggcgcgatagtctttacacagcgagccgtattttttgcacctatcggc
gaagcaaaaattgctgaaaataaaacaggtgcggcgatggcgttgggtagctttattggt
tacgctccggcgatgttctgcttcagtctgtatggctacattctggatttaaatccgggg
attattggctacaaaatcgtgtttggcattatggcctgcttcgcattcagtggtgcggtg
gtttccgtaatgctggttaagcgtattagccaacgtaagaaagagatgctggcggctgaa
gcttaa

DBGET integrated database retrieval system