KEGG   Escherichia coli K-12 W3110: JW3857Help
Entry
JW3857            CDS       T00068                                 

Gene name
rbn
Definition
(GenBank) tRNA processing exoribonuclease BN
  KO
K07058  membrane protein
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    JW3857 (rbn)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: BAE77423
UniProt: P0A8K8
Position
complement(3559663..3560535)
Genome map
AA seq 290 aa AA seqDB search
MLKTIQDKARHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAA
FPMFSDVSIQLRHFIFANFLPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSI
DSALNTIWRSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLNTVIDNV
LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL
IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEDDEP
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaaccattcaggacaaagccaggcaccgtacccgtccactatgggcctggcta
aaactactctggcaacgcattgatgaggacaacatgacaaccctggcaggtaaccttgcc
tatgtgtcgttgctctcattagtgccgctggttgccgttgtttttgcgcttttcgccgct
tttcccatgttttccgacgtcagcattcagttacgtcactttatttttgccaactttctg
cctgctactggcgatgttattcagcggtatatcgaacaatttgttgccaattccaacaag
atgaccgccgttggggcgtgcgggctgatcgtcaccgcgttattgttgatgtactccatc
gatagcgcgttgaataccatctggcgcagtaaacgagcgcgaccaaaaatttactcgttc
gccgtgtactggatgattttaacgctggggccgctgctggcaggggccagtctggcgatc
agttcctatttgctctccctgcgctgggcgagcgatctcaatactgtcatcgacaacgtg
ctgcgtatttttccgttgctgttgtcgtggatctccttctggttgctgtacagcattgtt
cctaccatccgcgtacctaaccgcgacgcgattgtcggcgcgtttgtcgccgcactcctg
ttcgaagcaggaaagaaaggtttcgcgctttatatcaccatgttcccgtcatatcagctc
atttatggtgtgctggcggtgatccccattctctttgtttgggtctactggacatggtgt
atcgtcttgcttggcgcggaaattactgtcactctcggggaataccgcaaactaaaacaa
gcagctgaacaagaagaagacgacgaaccatga

DBGET integrated database retrieval system