KEGG   Escherichia coli K-12 W3110: JW3864Help
Entry
JW3864            CDS       T00068                                 

Gene name
fdoH
Definition
(GenBank) formate dehydrogenase-O, Fe-S subunit
  KO
K00124  formate dehydrogenase iron-sulfur subunit
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00630  Glyoxylate and dicarboxylate metabolism
ecj00680  Methane metabolism
ecj01100  Metabolic pathways
ecj01120  Microbial metabolism in diverse environments
ecj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    JW3864 (fdoH)
  09102 Energy metabolism
   00680 Methane metabolism
    JW3864 (fdoH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_11 Form-deh_trans Fer4_7 Fer4_9 Fer4_10 Fer4_6 Fer4_21 Fer4_2 Fer4 Fer4_16 Fer4_3 Fer4_17 Fer4_4 Fer4_8 Fer4_22 Fer4_20 Fer4_18
Motif
Other DBs
NCBI-ProteinID: BAE77416
UniProt: P0AAJ5
Position
3553922..3554824
Genome map
AA seq 300 aa AA seqDB search
MAYQSQDIIRRSATNGLTPAPQARDFQEEVAKLIDVTTCIGCKACQVACSEWNDIRDTVG
NNIGVYDNPNDLSAKSWTVMRFSEVEQNDKLEWLIRKDGCMHCSDPGCLKACPAEGAIIQ
YANGIVDFQSEQCIGCGYCIAGCPFDIPRLNPEDNRVYKCTLCVDRVVVGQEPACVKTCP
TGAIHFGTKESMKTLASERVAELKTRGYDNAGLYDPAGVGGTHVMYVLHHADKPNLYHGL
PENPEISETVKFWKGIWKPLAAVGFAATFAASIFHYVGVGPNRADEEENNLHEEKDEERK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggcttatcaatctcaagatatcattcgtcgttccgcgactaacggtctgacccccgcg
cctcaggcgcgggacttccaggaagaagtggcgaaactcatcgacgttaccacctgtatc
ggctgtaaagcctgtcaggtggcgtgttcagagtggaacgacattcgcgataccgtcggc
aataacattggggtgtacgacaaccccaatgatttaagcgccaaatcgtggacggtaatg
cgcttctcggaagtggagcagaacgacaaactggaatggctgatccgcaaagacggctgt
atgcactgttccgatccaggctgcctgaaagcgtgcccggcggaaggtgcaattattcag
tatgccaacggtatcgtcgacttccagtccgagcagtgcattggctgcggttattgcatt
gcgggctgtccgttcgacattccgcgcctcaacccggaagacaaccgcgtctacaaatgt
acgctgtgcgttgaccgcgtggtggttgggcaagaaccagcctgcgtgaagacctgccca
acgggcgcgattcacttcggtacgaaagagtcgatgaaaacgctggcgagcgagcgcgtt
gctgagctgaaaacccgcggttacgacaatgcgggtctgtacgatccggcaggcgtcggt
ggtacacacgtcatgtacgtgctgcaccatgctgacaagccaaatctgtatcatggcttg
ccggagaacccggaaatcagcgaaaccgtgaaattctggaaaggcatctggaaaccgctc
gcggctgttggctttgcggctacctttgcggccagtatcttccactacgtgggtgtcggt
ccgaaccgtgcggatgaggaagagaataatctgcacgaagagaaagacgaggagcgcaaa
tga

DBGET integrated database retrieval system