KEGG   Escherichia coli K-12 W3110: JW3868Help
Entry
JW3868            CDS       T00068                                 

Gene name
frvR
Definition
(GenBank) predicted regulator
  KO
K18531  putative frv operon regulatory protein
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecj03000]
    JW3868 (frvR)
Transcription factors [BR:ecj03000]
 Prokaryotic Type
  Other transcription factors
   BglG family
    JW3868 (frvR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIA_2 HTH_11 HTH_AsnC-type HTH_24 HTH_5 HTH_DeoR HTH_Mga
Motif
Other DBs
NCBI-ProteinID: BAE77412
UniProt: P32152
Position
3546826..3548574
Genome map
AA seq 582 aa AA seqDB search
MLNERQLKIVDLLEQQPRTPGELAQQTGVSGRTILRDIDYLNFTLNGKARIFASGSAGYQ
LEIFERRSFFQLLQKHDNDDRLLALLLLNTFTPRAQLASALNLPETWVAERLPRLKQRYE
RTCCLASRPGLGHFIDETEEKRVILLANLLRKDPFLIPLAGITRDNLQHLSTACDNQHRW
PLMQGDYLSSLILAIYALRNQLTDEWPQYPGDEIKQIVEHSGLFLGDNAVRTLTGLIEKQ
HQQAQVISADNVQGLLQRVPGIASLNIIDAQLVENITGHLLRCLAAPVWIAEHRQSSMNN
LKAAWPAAFDMSLHFITLLREQLDIPLFDSDLIGLYFACALERHQNERQPIILLSDQNAI
ATINQLAIERDVLNCRVIIARSLSELVAIREEIEPLLIINNSHYLLDDAVNNYITVKNII
TAAGIEQIKHFLATAFIRQQPERFFSAPGSFHYSNVRGESWQHITRQICAQLVAQHHITA
DEAQRIIAREGEGENLIVNRLAIPHCWSEQERRFRGFFITLAQPVEVNNEVINHVLIACA
AADARHELKIFSYLASILCQHPAEIIAGLTGYEAFMELLHKG
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgctaaacgaacgccagttaaagattgtcgatctgctggagcaacagccgcgcacgcct
ggcgagctggcgcaacagactggcgtttcaggcaggaccatcctgcgtgatattgactat
ctcaacttcacccttaacggcaaagcccgcattttcgccagtggcagtgcgggctatcag
ctggaaatcttcgagcgccgcagcttttttcagttgctgcaaaagcacgataacgacgat
cggctgctggcgctgttattactgaatactttcactccccgtgcgcaactcgcctcggcg
cttaatttgccagaaacgtgggtagcagagcgtctgccccggttaaaacagcgttatgaa
cgcacttgttgcctggccagccgccctggtttgggccatttcattgatgagacagaagag
aaacgcgttatcttgctggcgaacttgctgcgcaaagatccgtttttaattccgctggcg
ggcataacacgagacaaccttcagcatttatccacggcctgcgacaaccaacaccgctgg
ccgctcatgcagggtgattatctctccagcctgattctggcgatttacgccctgcgtaat
caactgaccgatgagtggccgcaatatcccggtgacgagataaaacaaatcgttgaacat
agcggtctgtttcttggtgataacgctgtaagaaccctgacgggtttgatagagaaacag
catcagcaagcgcaggtaatttcagccgataatgtgcaggggttgctgcaaagggtgccg
ggcatcgcgtcattgaatattattgatgcgcagctggttgagaatattaccgggcattta
ttacgttgccttgccgcaccagtgtggattgctgagcaccgccagagcagcatgaataac
ctgaaagccgcctggcctgcggcctttgatatgagtctgcactttattacgctactgcgt
gaacagctcgatattccccttttcgacagcgatctgatcggtttgtattttgcctgtgcg
ctggagcggcatcaaaacgaacgccagccgatcattttgctctcggaccagaacgcgatt
gccactattaatcagctcgccattgagcgcgatgttttaaattgtcgggtaattattgcc
cgtagcttaagcgaacttgttgccattcgcgaagagattgagccgttattgatcattaac
aacagccattatttactggatgacgcggtaaataattacatcaccgtaaaaaatatcatt
acggctgccggtatcgaacaaataaaacattttctggcgacggcatttattcgccaacag
ccggagcgttttttctctgcccccggaagttttcattattcgaatgtacgcggtgaaagc
tggcaacatattacccggcaaatttgtgcgcaattagtcgcacaacaccatattaccgcc
gatgaagcacaacgcatcatcgcccgcgaaggcgaaggtgaaaacctgattgttaatcgc
ctcgccatcccacattgctggagcgaacaggagcgacgttttcgtggattttttattacc
ctcgcccaaccagttgaggtgaataacgaagtcattaaccatgtcttgatcgcctgcgcc
gccgccgatgcgcgtcatgagctaaaaatatttagctatctggcaagcatattgtgtcag
catccggcggagattattgccgggttaacaggatatgaggcatttatggagttacttcac
aaggggtga

DBGET integrated database retrieval system