KEGG   Escherichia coli K-12 W3110: JW3878
Entry
JW3878            CDS       T00068                                 

Gene name
rhaT
Definition
(GenBank) L-rhamnose:proton symporter
  KO
K02856  L-rhamnose-H+ transport protein
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW3878 (rhaT)
Transporters [BR:ecj02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   JW3878 (rhaT)
SSDB
Motif
Pfam: RhaT
Other DBs
NCBI-ProteinID: BAE77402
UniProt: P27125
Position
3536156..3537190
AA seq 344 aa
MSNAITMGIFWHLIGAASAACFYAPFKKVKKWSWETMWSVGGIVSWIILPWAISALLLPN
FWAYYSSFSLSTRLPVFLFGAMWGIGNINYGLTMRYLGMSMGIGIAIGITLIVGTLMTPI
INGNFDVLISTEGGRMTLLGVLVALIGVGIVTRAGQLKERKMGIKAEEFNLKKGLVLAVM
CGIFSAGMSFAMNAAKPMHEAAAALGVDPLYVALPSYVVIMGGGAIINLGFCFIRLAKVK
DLSLKADFSLAKSLIIHNVLLSTLGGLMWYLQFFFYAWGHARIPAQYDYISWMLHMSFYV
LCGGIVGLVLKEWNNAGRRPVTVLSLGCVVIIVAANIVGIGMAN
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgagtaacgcgattacgatggggatattttggcatttgatcggcgcggccagtgcagcc
tgtttttacgctccgttcaaaaaagtaaaaaaatggtcatgggaaaccatgtggtcagtc
ggtgggattgtttcgtggattattctgccgtgggccatcagcgccctgttactaccgaat
ttctgggcgtattacagctcgtttagtctctctacgcgactgcctgtttttctgttcggc
gctatgtgggggatcggtaatatcaactacggcctgaccatgcgttatctcggcatgtcg
atgggaattggcatcgccattggcattacgttgattgtcggtacgctgatgacgccaatt
atcaacggcaatttcgatgtgttgattagcaccgaaggcggacgcatgacgttgctcggc
gttctggtggcgctgattggcgtagggattgtaactcgcgccgggcagttgaaagagcgc
aagatgggcattaaagccgaagagttcaatctgaaaaaagggctggtgctggcggtgatg
tgcggcattttctctgccgggatgtcctttgcgatgaacgccgcaaaaccgatgcatgaa
gccgctgccgcacttggcgtcgatccactgtatgtcgctctgccaagctatgttgtcatc
atgggcggcggcgcgatcattaacctcggtttctgttttattcgtctggcaaaagtgaag
gatttgtcgctaaaagccgacttctcgctggcaaaatcgctgatcattcacaatgtgtta
ctctcgacactgggcgggttgatgtggtatctgcaattctttttctatgcctggggccac
gcccgcattccggcgcagtatgactacatcagttggatgctgcatatgagtttctatgta
ttgtgcggcggtatcgtcgggctggtgctgaaagagtggaacaatgcaggacgccgtccg
gtaacggtgttgagcctcggttgtgtggtgattattgtcgccgctaacatcgtcggcatc
ggcatggcgaattaa

DBGET integrated database retrieval system