KEGG   Escherichia coli K-12 W3110: JW3941Help
Entry
JW3941            CDS       T00068                                 

Gene name
birA
Definition
(GenBank) bifunctional biotin-[acetylCoA carboxylase] holoenzyme synthetase and DNA-binding transcriptional repressor, bio-5'-AMP-binding
  KO
K03524  BirA family transcriptional regulator, biotin operon repressor / biotin---[acetyl-CoA-carboxylase] ligase [EC:6.3.4.15]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00780  Biotin metabolism
ecj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    JW3941 (birA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecj03000]
    JW3941 (birA)
Enzymes [BR:ecj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     JW3941 (birA)
Transcription factors [BR:ecj03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    JW3941 (birA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPL_LplA_LipB HTH_11 BPL_C HTH_24 BPL_LplA_LipB_2 HTH_5 HTH_Crp_2 YdfA_immunity
Motif
Other DBs
NCBI-ProteinID: BAE77342
UniProt: P06709
Structure
PDB: 

Position
complement(3462634..3463599)
Genome map
AA seq 321 aa AA seqDB search
MKDNTVPLKLIALLANGEFHSGEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPGKGYSL
PEPIQLLNAKQILGQLDGGSVAVLPVIDSTNQYLLDRIGELKSGDACIAEYQQAGRGRRG
RKWFSPFGANLYLSMFWRLEQGPAAAIGLSLVIGIVMAEVLRKLGADKVRVKWPNDLYLQ
DRKLAGILVELTGKTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAA
MLIRELRAALELFEQEGLAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLL
EQDGIIKPWMGGEISLRSAEK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaggataacaccgtgccactgaaattgattgccctgttagcgaacggtgaatttcac
tctggcgagcagttgggtgaaacgctgggaatgagccgggcggctattaataaacacatt
cagacactgcgtgactggggcgttgatgtctttaccgttccgggtaaaggatacagcctg
cctgagcctatccagttacttaatgctaaacagatattgggtcagctggatggcggtagt
gtagccgtgctgccagtgattgactccacgaatcagtaccttcttgatcgtatcggagag
cttaaatcgggcgatgcttgcattgcagaataccagcaggctggccgtggtcgccggggt
cggaaatggttttcgccttttggcgcaaacttatatttgtcgatgttctggcgtctggaa
caaggcccggcggcggcgattggtttaagtctggttatcggtatcgtgatggcggaagta
ttacgcaagctgggtgcagataaagttcgtgttaaatggcctaatgacctctatctgcag
gatcgcaagctggcaggcattctggtggagctgactggcaaaactggcgatgcggcgcaa
atagtcattggagccgggatcaacatggcaatgcgccgtgttgaagagagtgtcgttaat
caggggtggatcacgctgcaggaagcggggatcaatctcgatcgtaatacgttggcggcc
atgctaatacgtgaattacgtgctgcgttggaactcttcgaacaagaaggattggcacct
tatctgtcgcgctgggaaaagctggataattttattaatcgcccagtgaaacttatcatt
ggtgataaagaaatatttggcatttcacgcggaatagacaaacagggggctttattactt
gagcaggatggaataataaaaccctggatgggcggtgaaatatccctgcgtagtgcagaa
aaataa

DBGET integrated database retrieval system