KEGG   Escherichia coli K-12 W3110: JW4028Help
Entry
JW4028            CDS       T00068                                 

Gene name
actP
Definition
(GenBank) acetate transporter
  KO
K14393  cation/acetate symporter
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW4028 (actP)
Transporters [BR:ecj02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   JW4028 (actP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSF DUF2818
Motif
Other DBs
NCBI-ProteinID: BAE78069
UniProt: P32705
Position
complement(4286843..4288492)
Genome map
AA seq 549 aa AA seqDB search
MKRVLTALAATLPFAANAADAISGAVERQPTNWQAIIMFLIFVVFTLGITYWASKRVRSR
SDYYTAGGNITGFQNGLAIAGDYMSAASFLGISALVFTSGYDGLIYSLGFLVGWPIILFL
IAERLRNLGRYTFADVASYRLKQGPIRILSACGSLVVVALYLIAQMVGAGKLIELLFGLN
YHIAVVLVGVLMMMYVLFGGMLATTWVQIIKAVLLLFGASFMAFMVMKHVGFSFNNLFSE
AMAVHPKGVDIMKPGGLVKDPISALSLGLGLMFGTAGLPHILMRFFTVSDAREARKSVFY
ATGFMGYFYILTFIIGFGAIMLVGANPEYKDAAGHLIGGNNMAAVHLANAVGGNLFLGFI
SAVAFATILAVVAGLTLAGASAVSHDLYANVFKKGATEREELRVSKITVLILGVIAIILG
VLFENQNIAFMVGLAFAIAASCNFPIILLSMYWSKLTTRGAMMGGWLGLITAVVLMILGP
TIWVQILGHEKAIFPYEYPALFSITVAFLGIWFFSATDNSAEGARERELFRAQFIRSQTG
FGVEQGRAH
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagttctgacggcgcttgccgccacactccctttcgcagctaacgccgcggat
gctattagcggggccgtagagcgccagccaacgaactggcaggcgattattatgttcctg
attttcgtcgtgtttacgctcggcattacctactgggcatcaaaacgcgtacgttctcgt
agcgactactacaccgcaggcggcaatatcactggcttccagaacgggctggcgattgcc
ggggactatatgtccgccgcctcattcttggggatctccgcgctggtgtttacctccggc
tatgacggcttaatttactcgctgggcttcctggtgggctggccgatcattttgttcctg
attgccgaacgtctgcgtaacctggggcgctacacctttgccgatgtggcctcttaccgt
ctgaaacaagggccgattcgtattctttcggcctgtggttctctggtggtggtggcgctt
taccttatcgcccagatggtgggcgcaggtaaactgatcgagctgctgtttggccttaac
tatcacattgcggtggtgctggtcggcgtgctgatgatgatgtacgtcctgttcggcggc
atgctggcgaccacctgggtgcaaattatcaaagccgtgctgttgctgttcggtgccagc
tttatggcctttatggtgatgaaacacgtcggctttagcttcaacaatctgttcagtgaa
gcgatggcggtacacccgaaaggtgtcgacatcatgaagccgggcgggctggtgaaagat
ccgatctccgcgctctctctgggtctgggactgatgtttggtacggcgggcttgccgcac
attctgatgcgcttctttacagtcagcgatgcccgcgaagcacgtaagagcgtgttctac
gccaccgggtttatgggctacttctatattctgacctttattatcggcttcggcgcgatc
atgctggttggtgcgaatccggaatataaagacgcggcgggccatctgattggtggtaac
aacatggcggccgttcacctggcgaatgcagtgggcggcaacctgttcctcggttttatt
tcagcggttgctttcgccactatcctcgcggtggttgcgggtctgacgctggcgggcgca
tccgcggtttcgcatgacttgtacgctaacgtcttcaaaaaaggcgcgaccgaacgtgaa
gagctgcgggtatcaaaaatcaccgtactgatcctcggcgtgattgcgattatcctcggc
gtgctgtttgagaatcagaacatcgcctttatggtggggctggcgtttgccatcgcggcg
agctgtaacttcccgatcattctgctttctatgtactggtcgaaactgaccacgcgtggc
gcgatgatgggtggctggctggggctgattaccgcagtagtactgatgatcctcggcccg
acgatttgggtacagatccttggtcacgaaaaagccatcttcccgtatgaatacccggcg
ctgttctctatcaccgtggcattcctcggcatctggttcttctcggcaaccgataactca
gcggaaggcgcgcgtgagcgtgaactgttccgcgcgcagtttatccgctcccagaccggc
tttggcgttgagcaaggccgcgcgcattaa

DBGET integrated database retrieval system