KEGG   Escherichia coli K-12 W3110: JW4037Help
Entry
JW4037            CDS       T00068                                 

Gene name
nrfG
Definition
(GenBank) heme lyase (NrfEFG) for insertion of heme into c552, subunit NrfG
  KO
K04018  formate-dependent nitrite reductase complex subunit NrfG
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    JW4037 (nrfG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_2 TPR_1 TPR_11 TPR_17 ANAPC3 TPR_12 ChAPs TPR_14 Pept_S41_N TPR_20
Motif
Other DBs
NCBI-ProteinID: BAE78078
UniProt: P32712
Structure
PDB: 

Position
4297133..4297729
Genome map
AA seq 198 aa AA seqDB search
MKQPKIPVKMLTTLTILMVFLCVGSYLLSPKWQAVRAEYQRQRDPLHQFASQQTPEAQLQ
ALQDKIRANPQNSEQWALLGEYYLWQNDYSNSLLAYRQALQLRGENAELYAALATVLYYQ
ASQHMTAQTRAMIDKALALDSNEITALMLLASDAFMQANYAQAIELWQKVMDLNSPRVNR
TQLVESINMAKLLQRRLD
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcccaaaataccggtgaaaatgctgacaacactcacgatattgatggtattt
ctctgtgtcggcagttatctgttaagcccaaaatggcaggcggtacgtgcggagtatcag
cgtcagcgcgatccgctacatcagtttgccagccagcaaaccccggaagcgcagcttcag
gcattgcaggataaaatccgcgctaatccacaaaacagcgaacagtgggcgttactgggc
gagtactatctgtggcaaaacgattacagcaattcgttgctggcgtaccgtcaggcgttg
caactacgtggtgagaacgctgaactgtatgcggcgctggcgacggtgctttattaccag
gccagccagcatatgaccgcccagactcgcgcaatgatcgacaaagccctcgcgctggac
agtaatgaaatcaccgccctgatgctgctggcttccgatgcgtttatgcaggcgaactac
gcgcaagccatcgaactatggcaaaaagtgatggatctcaactcaccgcgagttaaccga
acacagctggttgagtcgattaatatggcgaaattgttgcagcggagattggattaa

DBGET integrated database retrieval system