KEGG   Escherichia coli K-12 W3110: JW4061
Entry
JW4061            CDS       T00068                                 

Gene name
phnH
Definition
(GenBank) carbon-phosphorus lyase complex subunit
  KO
K06165  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnH [EC:2.7.8.37]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00440  Phosphonate and phosphinate metabolism
ecj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    JW4061 (phnH)
Enzymes [BR:ecj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.37  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase
     JW4061 (phnH)
SSDB
Motif
Pfam: PhnH DUF4092
Other DBs
NCBI-ProteinID: BAE78103
UniProt: P16686
Structure
PDB: 
4XB6 2FSU

Position
complement(4325341..4325925)
AA seq 194 aa
MTLETAFMLPVQDAQHSFRRLLKAMSEPGVIVALHQLKRGWQPLNIATTSVLLTLADNDT
PVWLSTPLNNDIVNQSLRFHTNAPLVSQPEQATFAVTDEAISSEQLNALSTGTAVAPEAG
ATLILQVASLSGGRMLRLTGAGIAEERMIAPQLPECILHELTERPHPFPLGIDLILTCGE
RLLAIPRTTHVEVC
NT seq 585 nt   +upstreamnt  +downstreamnt
atgaccctggaaaccgcttttatgcttcccgtgcaggatgcccagcacagttttcgtcgc
ctgttaaaggccatgagcgagccgggcgtgattgtcgccctgcatcagctcaaacgcggc
tggcaaccgctgaatatcgccaccaccagcgtgctgctgacgctggccgataacgacacg
ccggtgtggctttctaccccattaaataacgatatcgtcaaccagagcctgcgttttcat
accaacgcgccgctggtcagccagccggaacaggcgaccttcgcggtgacggatgaggcg
atttccagcgaacagctcaacgccctttccaccggcaccgccgttgcgccggaagcgggt
gcgacgctgattttacaggtcgccagcctgagcggcggacgcatgttgcgccttactggt
gcgggtattgccgaagaacgaatgatcgctccgcagctgccggagtgcattctgcacgaa
ctcaccgagcgcccgcatccgttcccgctcggcatcgacctgatcctgacctgtggcgag
cgcctgctggctattccgcgaaccactcatgtggaggtgtgctga

DBGET integrated database retrieval system